StarFunc result for job id Q7Z3Z4

User Input

>input (852 residues)
MSGRARVKARGIARSPSATEVGRIQASPLPRSVDLSNNEASSSNGFLGTSRISTNDKYGI
SSGDAGSTFMERGVKNKQDFMDLSICTREKLAHVRNCKTGSSGIPVKLVTNLFNLDFPQD
WQLYQYHVTYIPDLASRRLRIALLYSHSELSNKAKAFDGAILFLSQKLEEKVTELSSETQ
RGETIKMTITLKRELPSSSPVCIQVFNIIFRKILKKLSMYQIGRNFYNPSEPMEIPQHKL
SLWPGFAISVSYFERKLLFSADVSYKVLRNETVLEFMTALCQRTGLSCFTQTCEKQLIGL
IVLTRYNNRTYSIDDIDWSVKPTHTFQKRDGTEITYVDYYKQQYDITVSDLNQPMLVSLL
KKKRNDNSEAQLAHLIPELCFLTGLTDQATSDFQLMKAVAEKTRLSPSGRQQRLARLVDN
IQRNTNARFELETWGLHFGSQISLTGRIVPSEKILMQDHICQPVSAADWSKDIRTCKILN
AQSLNTWLILCSDRTEYVAESFLNCLRRVAGSMGFNVDYPKIIKVQENPAAFVRAIQQYV
DPDVQLVMCILPSNQKTYYDSIKKYLSSDCPVPSQCVLARTLNKQGMMMSIATKIAMQMT
CKLGGELWAVEIPLKSLMVVGIDVCKDALSKDVMVVGCVASVNPRITRWFSRCILQRTMT
DVADCLKVFMTGALNKWYKYNHDLPARIIVYRAGVGDGQLKTLIEYEVPQLLSSVAESSS
NTSSRLSVIVVRKKCMPRFFTEMNRTVQNPPLGTVVDSEATRNEWYDFYLISQVACRGTV
SPTYYNVIYDDNGLKPDHMQRLTFKLCHLYYNWPGIVSVPAPCQYAHKLTFLVAQSIHKE
PSLELANHLFYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A140VKG8	0.940	0.940	0.000	852	1.000	1.000	A0A140VKG8.pdb.gz	A0A140VKG8_HUMAN Piwi-like 4 (Drosophila), isoform CRA_a OS=Homo sapiens OX=9606 GN=PIWIL4 PE=2 SV=1
2	AFDB:Q4G033	0.899	0.903	0.000	848	0.766	0.770	Q4G033.pdb.gz	PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus OX=10116 GN=Piwil4 PE=2 SV=2
3	AFDB:Q8UVX0	0.888	0.882	0.000	858	0.475	0.472	Q8UVX0.pdb.gz	PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwil1 PE=1 SV=1
4	AFDB:Q9JMB7	0.887	0.877	0.000	862	0.492	0.486	Q9JMB7.pdb.gz	PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus OX=10090 GN=Piwil1 PE=1 SV=1
5	AFDB:Q7Z3Z3	0.863	0.835	1.275E-95	882	0.406	0.392	Q7Z3Z3.pdb.gz	PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens OX=9606 GN=PIWIL3 PE=2 SV=2
6	AFDB:A8KBF3	0.846	0.762	4.821E-94	949	0.354	0.318	A8KBF3.pdb.gz	PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis OX=8364 GN=piwil2 PE=1 SV=1
7	AFDB:Q8CDG1	0.855	0.752	1.351E-93	971	0.362	0.317	Q8CDG1.pdb.gz	PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus OX=10090 GN=Piwil2 PE=1 SV=2
8	AFDB:Q8TC59	0.855	0.750	1.426E-93	973	0.365	0.320	Q8TC59.pdb.gz	PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens OX=9606 GN=PIWIL2 PE=1 SV=1
9	AFDB:A2CEI6	0.845	0.692	1.390E-92	1046	0.356	0.290	A2CEI6.pdb.gz	PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio OX=7955 GN=piwil2 PE=1 SV=2
10	AFDB:Q7PLK0	0.852	0.837	9.274E-92	867	0.336	0.330	Q7PLK0.pdb.gz	AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster OX=7227 GN=AGO3 PE=1 SV=3
11	PDB:5guhA	0.824	0.920	1.030E-83	759	0.319	0.358	5guhA.pdb.gz	Crystal Structure of Silkworm PIWI-Clade Argonaute Siwi Bound to piRNA
12	PDB:6kr6A	0.722	0.850	1.298E-75	713	0.306	0.366	6kr6A.pdb.gz	Crystal structure of Drosophila Piwi.
13	PDB:4krfA	0.703	0.730	1.022E-57	817	0.214	0.223	4krfA.pdb.gz	The making of a slicer: activation of human argonaute-1.
14	PDB:4w5tA	0.695	0.730	1.207E-55	807	0.214	0.226	4w5tA.pdb.gz	Gene regulation. Structural basis for microRNA targeting.
15	PDB:6oonA	0.688	0.741	3.769E-55	785	0.208	0.225	6oonA.pdb.gz	Multidomain Convergence of Argonaute during RISC Assembly Correlates with the Formation of Internal Water Clusters.
16	PDB:5weaA	0.689	0.762	4.943E-55	764	0.211	0.236	5weaA.pdb.gz	Helix-7 in Argonaute2 shapes the microRNA seed region for rapid target recognition.
17	PDB:5vm9C	0.695	0.748	3.394E-53	785	0.212	0.231	5vm9C.pdb.gz	Human Argonaute3 has slicer activity.
18	PDB:7swfA	0.634	0.690	5.449E-46	778	0.210	0.230	7swfA.pdb.gz	The molecular mechanism of microRNA duplex selectivity of Arabidopsis ARGONAUTE10.
19	PDB:7kpvD	0.450	0.440	4.630E-16	876	0.109	0.106	7kpvD.pdb.gz
20	PDB:7vg3A	0.107	0.106	1.683E-6	860	0.053	0.052	7vg3A.pdb.gz	Mechanism of siRNA production by a plant Dicer-RNA complex in dicing-competent conformation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A140VKG8	0.0	1780	852	1.000	1.000	A0A140VKG8_HUMAN Piwi-like 4 (Drosophila), isoform CRA_a OS=Homo sapiens OX=9606 GN=PIWIL4 PE=2 SV=1
2	A2CEI6	0.0	588	1046	0.345	0.281	PIWL2_DANRE Piwi-like protein 2 OS=Danio rerio OX=7955 GN=piwil2 PE=1 SV=2
3	A8KBF3	0.0	583	949	0.336	0.301	PIWL2_XENTR Piwi-like protein 2 OS=Xenopus tropicalis OX=8364 GN=piwil2 PE=1 SV=1
4	A9ZSZ2	0.0	553	926	0.343	0.315	AGO3_BOMMO Piwi-like protein Ago3 OS=Bombyx mori OX=7091 GN=AGO3 PE=1 SV=2
5	Q4G033	0.0	1388	848	0.772	0.776	PIWL4_RAT Piwi-like protein 4 OS=Rattus norvegicus OX=10116 GN=Piwil4 PE=2 SV=2
6	Q7Z3Z3	0.0	645	882	0.385	0.372	PIWL3_HUMAN Piwi-like protein 3 OS=Homo sapiens OX=9606 GN=PIWIL3 PE=2 SV=2
7	Q7Z3Z4	0.0	1780	852	1.000	1.000	PIWL4_HUMAN Piwi-like protein 4 OS=Homo sapiens OX=9606 GN=PIWIL4 PE=1 SV=2
8	Q8CDG1	0.0	582	971	0.353	0.310	PIWL2_MOUSE Piwi-like protein 2 OS=Mus musculus OX=10090 GN=Piwil2 PE=1 SV=2
9	Q8CGT6	0.0	1402	848	0.775	0.778	PIWL4_MOUSE Piwi-like protein 4 OS=Mus musculus OX=10090 GN=Piwil4 PE=1 SV=3
10	Q8TC59	0.0	577	973	0.352	0.308	PIWL2_HUMAN Piwi-like protein 2 OS=Homo sapiens OX=9606 GN=PIWIL2 PE=1 SV=1
11	Q8UVX0	0.0	830	858	0.462	0.459	PIWL1_DANRE Piwi-like protein 1 OS=Danio rerio OX=7955 GN=piwil1 PE=1 SV=1
12	Q96J94	0.0	852	861	0.488	0.483	PIWL1_HUMAN Piwi-like protein 1 OS=Homo sapiens OX=9606 GN=PIWIL1 PE=1 SV=1
13	Q9JMB7	0.0	853	862	0.481	0.476	PIWL1_MOUSE Piwi-like protein 1 OS=Mus musculus OX=10090 GN=Piwil1 PE=1 SV=1
14	A8D8P8	7.45e-172	522	899	0.317	0.300	SIWI_BOMMO Piwi-like protein Siwi OS=Bombyx mori OX=7091 GN=Siwi PE=1 SV=1
15	Q7PLK0	4.26e-165	503	867	0.322	0.316	AGO3_DROME Protein argonaute-3 OS=Drosophila melanogaster OX=7227 GN=AGO3 PE=1 SV=3
16	Q9VKM1	1.32e-162	496	843	0.315	0.318	PIWI_DROME Protein piwi OS=Drosophila melanogaster OX=7227 GN=piwi PE=1 SV=1
17	O76922	7.19e-150	464	866	0.336	0.330	AUB_DROME Protein aubergine OS=Drosophila melanogaster OX=7227 GN=aub PE=1 SV=1
18	P90786	9.88e-144	447	824	0.306	0.317	P90786_CAEEL Piwi-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=prg-1 PE=1 SV=1
19	Q7KWS3	3.77e-113	370	979	0.268	0.233	Q7KWS3_DICDI Argonaut-like protein OS=Dictyostelium discoideum OX=44689 GN=agnA PE=3 SV=1
20	Q54G64	3.30e-106	350	900	0.279	0.264	Q54G64_DICDI Argonaut-like protein OS=Dictyostelium discoideum OX=44689 GN=agnB PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08699 ArgoL1	1.5e+02	13.5	Argonaute linker 1 domain
2	PF16486 ArgoN	0.0036	29.2	N-terminal domain of argonaute
3	PF02170 PAZ	1.1e-28	111.4	PAZ domain
4	PF02171 Piwi	2e-85	298.3	Piwi domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299001

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000387303	0.998	ATP-dependent RNA helicase TDRD9
2	9606.ENSP00000251864	0.986	Tudor domain-containing protein 1
3	9606.ENSP00000437256	0.984	Endoribonuclease Dicer
4	9606.ENSP00000359049	0.977	Small RNA 2'-O-methyltransferase
5	9606.ENSP00000335153	0.969	Heat shock protein HSP 90-alpha
6	9606.ENSP00000356846	0.967	Protein maelstrom homolog
7	9606.ENSP00000357812	0.964	Tudor and KH domain-containing protein
8	9606.ENSP00000252037	0.958	Inactive peptidyl-prolyl cis-trans isomerase FKBP6
9	9606.ENSP00000262794	0.955	RNA helicase Mov10l1
10	9606.ENSP00000379144	0.909	Trinucleotide repeat-containing gene 6A protein
11	9606.ENSP00000346065	0.908	Tudor domain-containing protein 6
12	9606.ENSP00000424838	0.884	Probable ATP-dependent RNA helicase DDX4
13	9606.ENSP00000390621	0.876	Putative ATP-dependent RNA helicase TDRD12
14	9606.ENSP00000255324	0.856	RING finger protein 17
15	9606.ENSP00000284629	0.843	Ankyrin repeat, SAM and basic leucine zipper domain-containing protein 1
16	9606.ENSP00000369786	0.819	Pirin
17	9606.ENSP00000425979	0.814	Ribonuclease 3
18	9606.ENSP00000415056	0.786	piRNA biogenesis protein EXD1
19	9606.ENSP00000406052	0.783	Tudor domain-containing protein 5
20	9606.ENSP00000317177	0.774	Mitochondrial cardiolipin hydrolase

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0061980	1.000	regulatory RNA binding
GO:0034584	0.949	piRNA binding
GO:0003824	0.932	catalytic activity
GO:0140640	0.893	catalytic activity, acting on a nucleic acid
GO:0140098	0.861	catalytic activity, acting on RNA
GO:0016787	0.851	hydrolase activity
GO:0004518	0.810	nuclease activity
GO:0004540	0.803	ribonuclease activity
GO:0004521	0.789	RNA endonuclease activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.992	multicellular organismal process
GO:0050789	0.965	regulation of biological process
GO:0009987	0.956	cellular process
GO:0050794	0.916	regulation of cellular process
GO:0048519	0.861	negative regulation of biological process
GO:0060255	0.851	regulation of macromolecule metabolic process
GO:0010468	0.843	regulation of gene expression
GO:0010669	0.809	epithelial structure maintenance
GO:0071704	0.697	organic substance metabolic process
GO:0006807	0.686	nitrogen compound metabolic process
GO:0043170	0.682	macromolecule metabolic process
GO:0044238	0.681	primary metabolic process
GO:0044237	0.650	cellular metabolic process
GO:0009892	0.619	negative regulation of metabolic process
GO:0010605	0.611	negative regulation of macromolecule metabolic process
GO:0048523	0.579	negative regulation of cellular process
GO:0016070	0.566	RNA metabolic process
GO:0031323	0.470	regulation of cellular metabolic process
GO:0051171	0.468	regulation of nitrogen compound metabolic process
GO:0032502	0.455	developmental process
GO:0010629	0.436	negative regulation of gene expression
GO:0080090	0.377	regulation of primary metabolic process
GO:0034660	0.370	ncRNA metabolic process
GO:0006396	0.347	RNA processing
GO:0048518	0.333	positive regulation of biological process
GO:0031047	0.315	RNA-mediated gene silencing
GO:0071840	0.306	cellular component organization or biogenesis

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005654	0.999	nucleoplasm
GO:0005829	0.902	cytosol
GO:0005739	0.852	mitochondrion
GO:0043232	0.594	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	0.851	Hydrolases.
EC:3.1.-.-	0.810	Acting on ester bonds.

[back to server]