StarFunc result for job id Q7Z401

User Input

>input (1863 residues)
MIEDKGPRVADYFVVAGLTDVSKPLEEEIHFNDACHKVAKPKEPITDVSVIIKSLGEEVP
QDYICIDVTPTGLSADLNNGSLVGPQIYLCYRRGRDKPPLTDLGVLYDWKERLKQGCEII
QSTPYGRPANISGSTSSQRIYITYRRASENMTQNTLAVTDICIIIPSKGESPPHTFCKVD
KNLNNSMWGSAVYLCYKKSVAKTNTVSYKAGLICRYPQEDYESFSLPESVPLFCLPMGAT
IECWPSNSKYPLPVFSTFVLTGASAEKVYGAAIQFYEPYSEENLTEKQRLLLGLTSADGK
SDSSKTIHTNKCICLLSHWPFFDAFRKFLTFLYRYSISGPHVLPIEKHISHFMHKVPFPS
PQRPRILVQLSPHDNLILSQPVSSPLPLSGGKFSTLLQNLGPENAVTLLVFAVTEHKILI
HSLRPSVLTSVTEALVSMIFPFHWPCPYVPLCPLALADVLSAPCPFIVGIDSRYFDLYDP
PPDVSCVDVDTNTISQIGDKKNVAWKILPKKPCKNLMNTLNNLHQQLAKLQQRPRDDGLM
DLAINDYDFNSGKRLHMIDLEIQEAFLFFMASILKGYRSYLRPITQAPSETATDAASLFA
LQAFLRSRDRSHQKFYNMMTKTQMFIRFIEECSFVSDKDASLAFFDDCVDKVDMDKSGEV
RLIELDESFKSEHTVFVTPPEIPHLPNGEEPPLQYSYNGFPVLRNNLFERPEGFLQAKKN
KLPSKSSSPNSPLPMFRRTKQEIKSAHKIAKRYSSIPQMWSRCLLRHCYGLWFICLPAYV
KVCHSKVRALKTAYDVLKKMQSKKMDPPDEVCYRILMQLCGQYDQPVLAVRVLFEMQKAG
IDPNAITYGYYNKAVLESTWPSRSRSGYFLWTKVRNVVLGVTQFKRALKKHAHLSQTTLS
GGQSDLGYNSLSKDEVRRGDTSTEDIQEEKDKKGSDCSSLSESESTKGSADCLPKLSYQN
SSSIVRLTGTSNNSAGKISGESMESTPELLLISSLEDTNETRNIQSRCFRKRHKSDNETN
LQQQVVWGNRNRNLSGGVLMGFMLNRINQEATPGDIVEKLGADAKILSNVISKSTRPNTL
DIGKPPLRSKRDSLEKESSDDDTPFDGSNYLADKVDSPVIFDLEDLDSETDVSKAGCVAT
QNPKRIQRMNSSFSVKPFEKTDVATGFDPLSLLVAETEQQQKEEEEEDEDDSKSISTPSA
RRDLAEEIVMYMNNMSSPLTSRTPSIDLQRACDDKLNKKSPPLVKACRRSSLPPNSPKPV
RLTKSKSYTKSEEKPRDRLWSSPAFSPTCPFREESQDTLTHSSPSFNLDTLLVPKLDVLR
NSMFTAGKGVAEKASKWYSRFTMYTTSSKDQSSDRTSLSSVGAQDSESTSLTDEDVCHEL
EGPISSQETSATSGTKRIDLSRISLESSASLEGSLSKFALPGKSEVTSSFNASNTNIFQN
YAMEVLISSCSRCRTCDCLVHDEEIMAGWTADDSNLNTTCPFCGNIFLPFLNIEIRDLRR
PGRYFLKSSPSTENMHFPSSISSQTRQSCISTSASGLDTSALSVQGNFDLNSKSKLQENF
CTRSIQIPANRSKTAMSKCPIFPMARSISTSGPLDKEDTGRQKLISTGSLPATLQGATDS
LGLEWHLPSPDPVTVPYLSPLVVWKELESLLENEGDHAITVADFVDHHPIVFWNLVWYFR
RLDLPSNLPGLILSSEHCNKYSKIPRHCMSEDSKYVLIQMLWDNMKLHQDPGQPLYILWN
AHTQKYPMVHLLQKSDNSFNQELLKSMVKSIKMNDVYGPMSQILETLNKCPHFKRQRSLY
REILFLSLVALGRENIDIDAFDKEYKMAYDRLTPSQVKSTHNCDRPPSTGVMECRKTFGE
PYL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A6H8H2	0.640	0.626	0.000	1906	0.491	0.480	A6H8H2.pdb.gz	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
2	AFDB:Q5VZ89	0.648	0.633	0.000	1909	0.487	0.476	Q5VZ89.pdb.gz	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
3	AFDB:Q7Z401	1.000	1.000	0.000	1863	1.000	1.000	Q7Z401.pdb.gz	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
4	AFDB:Q9W3D3	0.584	0.649	0.000	1671	0.340	0.379	Q9W3D3.pdb.gz	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
5	PDB:6ulgL	0.071	0.207	4.350E-3	458	0.031	0.127	6ulgL.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
6	PDB:6nzdH	0.057	0.224	2.423E-2	387	0.031	0.150	6nzdH.pdb.gz	Structural mechanism of a Rag GTPase activation checkpoint by the lysosomal folliculin complex.
7	AFDB:A0A1D8PLJ2	0.034	0.049	3.168E-2	1141	0.076	0.124	A0A1D8PLJ2.pdb.gz	A0A1D8PLJ2_CANAL Bem3p OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BEM3 PE=4 SV=1
8	AFDB:A8JNM1	0.040	0.041	4.512E-2	1717	0.079	0.086	A8JNM1.pdb.gz	A8JNM1_DROME Formin 3, isoform B OS=Drosophila melanogaster OX=7227 GN=form3 PE=4 SV=1
9	AFDB:Q9W1R4	0.041	0.050	5.808E-2	1395	0.091	0.122	Q9W1R4.pdb.gz	ICE1_DROME Little elongation complex subunit 1 OS=Drosophila melanogaster OX=7227 GN=Ice1 PE=1 SV=2
10	AFDB:Q7Z2Z1	0.059	0.058	8.700E-2	1910	0.100	0.097	Q7Z2Z1.pdb.gz	TICRR_HUMAN Treslin OS=Homo sapiens OX=9606 GN=TICRR PE=1 SV=2
11	AFDB:Q8IWB6	0.031	0.035	1.012E-1	1497	0.077	0.096	Q8IWB6.pdb.gz	TEX14_HUMAN Inactive serine/threonine-protein kinase TEX14 OS=Homo sapiens OX=9606 GN=TEX14 PE=1 SV=2
12	PDB:3fcsA	0.031	0.046	1.570E-1	913	0.013	0.026	3fcsA.pdb.gz	Structure of a complete integrin ectodomain in a physiologic resting state and activation and deactivation by applied forces.
13	AFDB:Q6DRL4	0.038	0.038	2.643E-1	1824	0.116	0.118	Q6DRL4.pdb.gz	TICRR_DANRE Treslin OS=Danio rerio OX=7955 GN=ticrr PE=2 SV=1
14	PDB:6lt0B	0.048	0.167	3.705E-1	386	0.011	0.054	6lt0B.pdb.gz
15	PDB:6ulgN	0.059	0.158	4.099E-1	483	0.029	0.112	6ulgN.pdb.gz	Cryo-EM Structure of the Human FLCN-FNIP2-Rag-Ragulator Complex.
16	PDB:4m57A	0.039	0.087	5.837E-1	702	0.030	0.078	4m57A.pdb.gz
17	PDB:6jcyC	0.032	0.043	6.792E-1	1139	0.021	0.034	6jcyC.pdb.gz	Structures and mechanism of transcription initiation by bacterial ECF factors.
18	PDB:6hivBI	0.045	0.214	7.144E-1	319	0.010	0.060	6hivBI.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
19	PDB:7mgeB	0.050	0.170	7.903E-1	442	0.012	0.052	7mgeB.pdb.gz	Structural basis for the ARF GAP activity and specificity of the C9orf72 complex.
20	PDB:5dizA	0.043	0.153	8.313E-1	474	0.010	0.040	5dizA.pdb.gz	Nuclear Protein-Only Ribonuclease P2 Structure and Biochemical Characterization Provide Insight into the Conserved Properties of tRNA 5' End Processing Enzymes.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A6H8H2	0.0	1646	1906	0.513	0.502	DEN4C_MOUSE DENN domain-containing protein 4C OS=Mus musculus OX=10090 GN=Dennd4c PE=1 SV=1
2	O75064	0.0	1078	1496	0.276	0.344	DEN4B_HUMAN DENN domain-containing protein 4B OS=Homo sapiens OX=9606 GN=DENND4B PE=1 SV=4
3	Q5VZ89	0.0	1663	1909	0.508	0.496	DEN4C_HUMAN DENN domain-containing protein 4C OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=3
4	Q7Z401	0.0	3863	1863	1.000	1.000	MYCPP_HUMAN C-myc promoter-binding protein OS=Homo sapiens OX=9606 GN=DENND4A PE=1 SV=2
5	Q9W3D3	0.0	793	1671	0.230	0.257	CRAG_DROME DENN domain-containing protein Crag OS=Drosophila melanogaster OX=7227 GN=Crag PE=1 SV=3
6	X6R5W5	1.06e-126	417	696	0.154	0.411	X6R5W5_HUMAN DENN domain containing 4C (Fragment) OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=1
7	X6RAE7	7.86e-102	351	881	0.139	0.294	X6RAE7_HUMAN DENN domain containing 4C (Fragment) OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=1
8	A0A0A0MRX3	9.22e-33	134	353	0.057	0.303	A0A0A0MRX3_HUMAN DENN domain containing 4C (Fragment) OS=Homo sapiens OX=9606 GN=DENND4C PE=1 SV=1
9	Q86WG5	1.35e-31	138	1849	0.070	0.070	MTMRD_HUMAN Myotubularin-related protein 13 OS=Homo sapiens OX=9606 GN=SBF2 PE=1 SV=1
10	E9PXF8	8.32e-31	135	1872	0.061	0.060	MTMRD_MOUSE Myotubularin-related protein 13 OS=Mus musculus OX=10090 GN=Sbf2 PE=1 SV=1
11	Q6ZUT9	1.57e-29	131	1274	0.070	0.102	DEN5B_HUMAN DENN domain-containing protein 5B OS=Homo sapiens OX=9606 GN=DENND5B PE=1 SV=2
12	Q7KSP6	4.12e-29	130	1973	0.067	0.063	Q7KSP6_DROME SET domain binding factor, isoform B OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=1
13	Q9VGH9	4.39e-29	130	1993	0.067	0.062	Q9VGH9_DROME SET domain binding factor, isoform A OS=Drosophila melanogaster OX=7227 GN=Sbf PE=1 SV=3
14	M0RAP5	4.88e-29	130	1893	0.062	0.061	M0RAP5_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
15	Q6ZPE2	1.58e-28	128	1867	0.061	0.061	MTMR5_MOUSE Myotubularin-related protein 5 OS=Mus musculus OX=10090 GN=Sbf1 PE=1 SV=2
16	A0A8I6AD51	1.87e-28	128	1875	0.062	0.061	A0A8I6AD51_RAT SET binding factor 1 OS=Rattus norvegicus OX=10116 GN=Sbf1 PE=1 SV=1
17	O95248	6.51e-27	123	1868	0.060	0.059	MTMR5_HUMAN Myotubularin-related protein 5 OS=Homo sapiens OX=9606 GN=SBF1 PE=1 SV=4
18	Q8RXA7	1.77e-26	121	1187	0.070	0.110	SCD1_ARATH DENN domain and WD repeat-containing protein SCD1 OS=Arabidopsis thaliana OX=3702 GN=SCD1 PE=1 SV=1
19	Q6PAL8	2.41e-26	120	1287	0.048	0.069	DEN5A_MOUSE DENN domain-containing protein 5A OS=Mus musculus OX=10090 GN=Dennd5a PE=1 SV=1
20	G3V7Q0	2.71e-26	120	1287	0.048	0.069	DEN5A_RAT DENN domain-containing protein 5A OS=Rattus norvegicus OX=10116 GN=Dennd5a PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03455 dDENN	1.7e-10	52.1	dDENN domain
2	PF02141 DENN	3.9e-56	201.4	DENN (AEX-3) domain
3	PF01535 PPR	62	15.3	PPR repeat
4	PF13041 PPR_2	0.00077	30.9	PPR repeat family
5	PF13812 PPR_3	4.2	18.8	Pentatricopeptide repeat domain
6	PF17177 PPR_long	0.19	22.5	Pentacotripeptide-repeat region of PRORP
7	PF03456 uDENN	1.2e-11	56.2	uDENN domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000391167

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264710	0.947	Ras-related protein Rab-10
2	9606.ENSP00000350386	0.902	Rab proteins geranylgeranyltransferase component A 1
3	9606.ENSP00000355511	0.902	Rab proteins geranylgeranyltransferase component A 2
4	9606.ENSP00000369538	0.900	Rab GDP dissociation inhibitor beta
5	9606.ENSP00000394071	0.900	Rab GDP dissociation inhibitor alpha
6	9606.ENSP00000386226	0.686	RNA-binding protein 34
7	9606.ENSP00000463325	0.677	Receptor-type tyrosine-protein phosphatase mu
8	9606.ENSP00000373301	0.603	SH3 domain-binding protein 5
9	9606.ENSP00000322270	0.598	Adhesion G protein-coupled receptor L2
10	9606.ENSP00000342295	0.520	Ankyrin repeat domain-containing protein 55
11	9606.ENSP00000337688	0.516	Translocation protein SEC62
12	9606.ENSP00000310933	0.515	MAP kinase-activating death domain protein
13	9606.ENSP00000356432	0.513	BMP/retinoic acid-inducible neural-specific protein 3
14	9606.ENSP00000324196	0.500	Serine/threonine-protein kinase LMTK1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.993	cellular process
GO:0050896	0.978	response to stimulus
GO:0051179	0.918	localization
GO:0051641	0.906	cellular localization
GO:0051668	0.834	localization within membrane
GO:0065007	0.827	biological regulation
GO:0050789	0.795	regulation of biological process
GO:0033036	0.778	macromolecule localization
GO:0051716	0.733	cellular response to stimulus
GO:0008104	0.705	protein localization
GO:0050794	0.682	regulation of cellular process
GO:0072657	0.397	protein localization to membrane
GO:0042221	0.328	response to chemical

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043229	0.956	intracellular organelle
GO:0043227	0.953	membrane-bounded organelle
GO:0043231	0.941	intracellular membrane-bounded organelle
GO:0012505	0.808	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]