StarFunc result for job id Q7Z406

User Input

>input (1995 residues)
MAAVTMSVPGRKAPPRPGPVPEAAQPFLFTPRGPSAGGGPGSGTSPQVEWTARRLVWVPS
ELHGFEAAALRDEGEEEAEVELAESGRRLRLPRDQIQRMNPPKFSKAEDMAELTCLNEAS
VLHNLRERYYSGLIYTYSGLFCVVINPYKQLPIYTEAIVEMYRGKKRHEVPPHVYAVTEG
AYRSMLQDREDQSILCTGESGAGKTENTKKVIQYLAHVASSPKGRKEPGVPGELERQLLQ
ANPILEAFGNAKTVKNDNSSRFGKFIRINFDVAGYIVGANIETYLLEKSRAIRQAKDECS
FHIFYQLLGGAGEQLKADLLLEPCSHYRFLTNGPSSSPGQERELFQETLESLRVLGFSHE
EIISMLRMVSAVLQFGNIALKRERNTDQATMPDNTAAQKLCRLLGLGVTDFSRALLTPRI
KVGRDYVQKAQTKEQADFALEALAKATYERLFRWLVLRLNRALDRSPRQGASFLGILDIA
GFEIFQLNSFEQLCINYTNEKLQQLFNHTMFVLEQEEYQREGIPWTFLDFGLDLQPCIDL
IERPANPPGLLALLDEECWFPKATDKSFVEKVAQEQGGHPKFQRPRHLRDQADFSVLHYA
GKVDYKANEWLMKNMDPLNDNVAALLHQSTDRLTAEIWKDVEGIVGLEQVSSLGDGPPGG
RPRRGMFRTVGQLYKESLSRLMATLSNTNPSFVRCIVPNHEKRAGKLEPRLVLDQLRCNG
VLEGIRICRQGFPNRILFQEFRQRYEILTPNAIPKGFMDGKQACEKMIQALELDPNLYRV
GQSKIFFRAGVLAQLEEERDLKVTDIIVSFQAAARGYLARRAFQKRQQQQSALRVMQRNC
AAYLKLRHWQWWRLFTKVKPLLQVTRQDEVLQARAQELQKVQELQQQSAREVGELQGRVA
QLEEERARLAEQLRAEAELCAEAEETRGRLAARKQELELVVSELEARVGEEEECSRQMQT
EKKRLQQHIQELEAHLEAEEGARQKLQLEKVTTEAKMKKFEEDLLLLEDQNSKLSKERKL
LEDRLAEFSSQAAEEEEKVKSLNKLRLKYEATIADMEDRLRKEEKGRQELEKLKRRLDGE
SSELQEQMVEQQQRAEELRAQLGRKEEELQAALARAEDEGGARAQLLKSLREAQAALAEA
QEDLESERVARTKAEKQRRDLGEELEALRGELEDTLDSTNAQQELRSKREQEVTELKKTL
EEETRIHEAAVQELRQRHGQALGELAEQLEQARRGKGAWEKTRLALEAEVSELRAELSSL
QTARQEGEQRRRRLELQLQEVQGRAGDGERARAEAAEKLQRAQAELENVSGALNEAESKT
IRLSKELSSTEAQLHDAQELLQEETRAKLALGSRVRAMEAEAAGLREQLEEEAAARERAG
RELQTAQAQLSEWRRRQEEEAGALEAGEEARRRAAREAEALTQRLAEKTETVDRLERGRR
RLQQELDDATMDLEQQRQLVSTLEKKQRKFDQLLAEEKAAVLRAVEERERAEAEGREREA
RALSLTRALEEEQEAREELERQNRALRAELEALLSSKDDVGKSVHELERACRVAEQAAND
LRAQVTELEDELTAAEDAKLRLEVTVQALKTQHERDLQGRDEAGEERRRQLAKQLRDAEV
ERDEERKQRTLAVAARKKLEGELEELKAQMASAGQGKEEAVKQLRKMQAQMKELWREVEE
TRTSREEIFSQNRESEKRLKGLEAEVLRLQEELAASDRARRQAQQDRDEMADEVANGNLS
KAAILEEKRQLEGRLGQLEEELEEEQSNSELLNDRYRKLLLQVESLTTELSAERSFSAKA
ESGRQQLERQIQELRGRLGEEDAGARARHKMTIAALESKLAQAEEQLEQETRERILSGKL
VRRAEKRLKEVVLQVEEERRVADQLRDQLEKGNLRVKQLKRQLEEAEEEASRAQAGRRRL
QRELEDVTESAESMNREVTTLRNRLRRGPLTFTTRTVRQVFRLEEGVASDEEAEEAQPGS
GPSPEPEGSPPAHPQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0N4STT5	0.640	0.636	0.000	2008	0.363	0.361	A0A0N4STT5.pdb.gz
2	AFDB:A1L219	0.412	0.751	0.000	1046	0.370	0.706	A1L219.pdb.gz
3	AFDB:A7E2Y1	0.633	0.637	0.000	1983	0.381	0.383	A7E2Y1.pdb.gz	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
4	AFDB:B3DFS9	0.737	0.744	0.000	1974	0.601	0.607	B3DFS9.pdb.gz
5	AFDB:B8A568	0.675	0.694	0.000	1937	0.352	0.362	B8A568.pdb.gz	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
6	AFDB:B8JLS3	0.641	0.659	0.000	1936	0.357	0.368	B8JLS3.pdb.gz
7	AFDB:E7FD18	0.656	0.672	0.000	1945	0.365	0.374	E7FD18.pdb.gz
8	AFDB:F1QC64	0.640	0.725	0.000	1749	0.554	0.632	F1QC64.pdb.gz
9	AFDB:F1R3G4	0.695	0.696	0.000	1992	0.655	0.656	F1R3G4.pdb.gz	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
10	AFDB:G5EBY3	0.629	0.627	0.000	2003	0.432	0.430	G5EBY3.pdb.gz	G5EBY3_CAEEL Myosin-11 OS=Caenorhabditis elegans OX=6239 GN=nmy-2 PE=1 SV=1
11	PDB:7mf3B	0.364	0.790	8.660E-88	896	0.335	0.747	7mf3B.pdb.gz	Cryo-EM structure of the autoinhibited state of myosin-2.
12	PDB:4pa0A	0.312	0.619	1.381E-74	974	0.187	0.384	4pa0A.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
13	PDB:4pa0B	0.309	0.650	2.276E-70	920	0.181	0.392	4pa0B.pdb.gz	Structural basis for drug-induced allosteric changes to human beta-cardiac myosin motor activity.
14	PDB:4p7hB	0.312	0.634	1.653E-67	952	0.182	0.381	4p7hB.pdb.gz
15	PDB:5tbyA	0.344	0.686	4.385E-67	954	0.216	0.452	5tbyA.pdb.gz
16	PDB:4anjA	0.333	0.654	3.953E-61	995	0.132	0.265	4anjA.pdb.gz	Processive Steps in the Reverse Direction Require Uncoupling of the Lead Head Lever Arm of Myosin Vi.
17	PDB:6ycxB	0.353	0.820	1.171E-56	817	0.112	0.273	6ycxB.pdb.gz	Full-length Plasmodium falciparum myosin A and essential light chain PfELC structures provide new anti-malarial targets.
18	PDB:6fyxo	0.045	0.097	7.070E-2	529	0.038	0.144	6fyxo.pdb.gz	Translational initiation factor eIF5 replaces eIF1 on the 40S ribosomal subunit to promote start-codon recognition.
19	PDB:6zmwu	0.054	0.088	8.594E-2	706	0.045	0.127	6zmwu.pdb.gz	Structure of a human 48Stranslational initiation complex.
20	PDB:2eyqA	0.035	0.053	2.911E-1	1146	0.014	0.024	2eyqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JY53	999	1922	0.331	0.343	A0A0G2JY53_RAT Myosin, heavy chain 15 OS=Rattus norvegicus OX=10116 GN=Myh15 PE=3 SV=2
2	A0A0G2K0F5	1196	1912	0.364	0.380	A0A0G2K0F5_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=2
3	A0A0G2K1V4	1186	1937	0.363	0.374	A0A0G2K1V4_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
4	A0A0G2K484	1202	1939	0.366	0.376	A0A0G2K484_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=2
5	A0A0R4INI3	1193	1938	0.364	0.375	A0A0R4INI3_DANRE Slow myosin heavy chain 1 OS=Danio rerio OX=7955 GN=fb18g10 PE=1 SV=1
6	A0A1D8PN92	724	1948	0.232	0.237	A0A1D8PN92_CANAL Myosin 1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=MYO1 PE=3 SV=1
7	A2AQP0	1132	1941	0.379	0.389	MYH7B_MOUSE Myosin-7B OS=Mus musculus OX=10090 GN=Myh7b PE=3 SV=1
8	A6QLN6	2469	1972	0.623	0.630	A6QLN6_BOVIN MYH11 protein OS=Bos taurus OX=9913 GN=MYH11 PE=1 SV=1
9	A7E2Y1	1133	1983	0.379	0.381	MYH7B_HUMAN Myosin-7B OS=Homo sapiens OX=9606 GN=MYH7B PE=1 SV=4
10	B1AR69	1165	1938	0.362	0.373	B1AR69_MOUSE Myosin, heavy polypeptide 13, skeletal muscle OS=Mus musculus OX=10090 GN=Myh13 PE=1 SV=1
11	B6IDE1	1220	1939	0.367	0.378	B6IDE1_DANRE Slow myosin heavy chain 2 OS=Danio rerio OX=7955 GN=MYH7 PE=1 SV=1
12	B6RK61	1140	1941	0.380	0.391	B6RK61_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=2 SV=1
13	B8A568	1167	1937	0.360	0.371	B8A568_DANRE Myosin, heavy polypeptide 1.1, skeletal muscle OS=Danio rerio OX=7955 GN=cb20 PE=1 SV=1
14	F1LMU0	1196	1939	0.359	0.370	F1LMU0_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh4 PE=1 SV=1
15	F1LRV9	1194	1943	0.366	0.376	F1LRV9_RAT Myosin heavy chain 4 OS=Rattus norvegicus OX=10116 GN=Myh1 PE=1 SV=3
16	F1QZW1	1206	1938	0.366	0.377	F1QZW1_DANRE Myosin heavy chain 7 OS=Danio rerio OX=7955 GN=mg:cb02g011 PE=1 SV=1
17	F1R3G4	2588	1992	0.656	0.657	F1R3G4_DANRE Myosin, heavy chain 10, non-muscle OS=Danio rerio OX=7955 GN=myh10 PE=1 SV=1
18	F7F0L5	1102	1929	0.373	0.386	F7F0L5_RAT Myosin heavy chain 7B OS=Rattus norvegicus OX=10116 GN=Myh7b PE=3 SV=1
19	G3UW82	1206	1942	0.364	0.374	G3UW82_MOUSE Myosin, heavy polypeptide 2, skeletal muscle, adult OS=Mus musculus OX=10090 GN=Myh2 PE=1 SV=1
20	G3V6E1	1207	1942	0.365	0.375	G3V6E1_RAT Myosin heavy chain 2 OS=Rattus norvegicus OX=10116 GN=Myh2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13401 AAA_22	4.1e+02	12.6	AAA domain
2	PF11559 ADIP	0.008	27.7	Afadin- and alpha -actinin-Binding
3	PF00612 IQ	2.7	19.0	IQ calmodulin-binding motif
4	PF00063 Myosin_head	3.9e-284	955.8	Myosin head (motor domain)
5	PF02736 Myosin_N	0.0038	28.3	Myosin N-terminal SH3-like domain
6	PF01576 Myosin_tail_1	0	1534.0	Myosin tail

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000470298

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000217652	0.991	Myosin regulatory light chain 12A
2	9606.ENSP00000446955	0.973	Myosin light polypeptide 6
3	9606.ENSP00000279022	0.968	Myosin regulatory light polypeptide 9
4	9606.ENSP00000450385	0.966	Myosin light chain 6B
5	9606.ENSP00000228841	0.963	Myosin regulatory light chain 2, ventricular/cardiac muscle isoform
6	9606.ENSP00000476755	0.962	Protein phosphatase 1 regulatory subunit 12B
7	9606.ENSP00000463559	0.960	Myosin regulatory light chain 12B
8	9606.ENSP00000325239	0.957	Myosin light chain, phosphorylatable, fast skeletal muscle
9	9606.ENSP00000307280	0.955	Myosin light chain 1/3, skeletal muscle isoform
10	9606.ENSP00000353452	0.951	Myosin light chain kinase, smooth muscle
11	9606.ENSP00000379210	0.948	Myosin light chain 3
12	9606.ENSP00000383023	0.947	Myosin light chain 5
13	9606.ENSP00000216181	0.940	Myosin-9
14	9606.ENSP00000379616	0.939	Myosin-11
15	9606.ENSP00000389168	0.936	Protein phosphatase 1 regulatory subunit 12A
16	9606.ENSP00000376306	0.934	Citron Rho-interacting kinase
17	9606.ENSP00000349960	0.932	Actin, cytoplasmic 1
18	9606.ENSP00000400175	0.929	Transforming protein RhoA
19	9606.ENSP00000223167	0.926	Myosin regulatory light chain 10
20	9606.ENSP00000353590	0.926	Myosin-10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0000146	1.000	microfilament motor activity
GO:0051015	0.998	actin filament binding
GO:0097159	0.868	organic cyclic compound binding
GO:1901363	0.867	heterocyclic compound binding
GO:0043167	0.853	ion binding
GO:0043168	0.836	anion binding
GO:0032555	0.814	purine ribonucleotide binding
GO:0032559	0.787	adenyl ribonucleotide binding
GO:0035639	0.673	purine ribonucleoside triphosphate binding
GO:0005524	0.658	ATP binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.994	cellular process
GO:0030029	0.954	actin filament-based process
GO:0032501	0.919	multicellular organismal process
GO:0065007	0.883	biological regulation
GO:0050789	0.818	regulation of biological process
GO:0048856	0.738	anatomical structure development
GO:0030048	0.718	actin filament-based movement
GO:0071840	0.691	cellular component organization or biogenesis
GO:0016043	0.667	cellular component organization
GO:0050794	0.542	regulation of cellular process
GO:0006996	0.442	organelle organization
GO:0009653	0.422	anatomical structure morphogenesis
GO:0007010	0.399	cytoskeleton organization
GO:0050896	0.395	response to stimulus
GO:0007275	0.337	multicellular organism development
GO:0003008	0.333	system process
GO:0030036	0.316	actin cytoskeleton organization
GO:0006936	0.310	muscle contraction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0015629	1.000	actin cytoskeleton
GO:0032991	0.999	protein-containing complex
GO:0043227	0.999	membrane-bounded organelle
GO:0005829	0.998	cytosol
GO:0099512	0.996	supramolecular fiber
GO:0016459	0.988	myosin complex
GO:0016020	0.981	membrane
GO:0043231	0.978	intracellular membrane-bounded organelle
GO:0031982	0.967	vesicle
GO:0005576	0.964	extracellular region
GO:0071944	0.946	cell periphery
GO:0070062	0.883	extracellular exosome
GO:0042641	0.827	actomyosin
GO:0005634	0.671	nucleus
GO:0005886	0.669	plasma membrane
GO:0016460	0.624	myosin II complex
GO:0012505	0.562	endomembrane system
GO:0043233	0.540	organelle lumen
GO:0070013	0.523	intracellular organelle lumen
GO:0043292	0.523	contractile fiber
GO:0005654	0.428	nucleoplasm
GO:0120025	0.379	plasma membrane bounded cell projection
GO:0032982	0.347	myosin filament
GO:0099513	0.333	polymeric cytoskeletal fiber
GO:0030054	0.329	cell junction

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:5.6.1.8	1.000	myosin ATPase.

[back to server]