StarFunc result for job id Q7Z407

User Input

>input (1400 residues)
MKGIRKGESRAKESKPWEPGKRRCAKCGRLDFILMKKMGIKSGFTFWNLVFLLTVSCVKG
FIYTCGGTLKGLNGTIESPGFPYGYPNGANCTWVIIAEERNRIQIVFQSFALEEEYDYLS
LYDGHPHPTNFRTRLTGFHLPPPVTSTKSVFSLRLTSDFAVSAHGFKVYYEELQSSSCGN
PGVPPKGVLYGTRFDVGDKIRYSCVTGYILDGHPQLTCIANSVNTASWDFPVPICRAEDA
CGGTMRGSSGIISSPSFPNEYHNNADCTWTIVAEPGDTISLIFTDFQMEEKYDYLEIEGS
EPPTIWLSGMNIPPPIISNKNWLRLHFVTDSNHRYRGFSAPYQGSSTLTHTTSTGELEEH
NRTTTGAIAVASTPADVTVSSVTAVTIHRLSEEQRVQVTSLRNSGLDPNTSKDGLSPHPA
DTQSTRRRPRHAEQIERTKELAVVTHRVKKAIDFKSRGFKLFPGKDNSNKFSILNEGGIK
TASNLCPDPGEPENGKRIGSDFSLGSTVQFSCDEDYVLQGAKSITCQRIAEVFAAWSDHR
PVCKVKTCGSNLQGPSGTFTSPNFPFQYDSNAQCVWVITAVNTNKVIQINFEEFDLEIGY
DTLTIGDGGEVGDPRTVLQVLTGSFVPDLIVSMSSQMWLHLQTDESVGSVGFKVNYKEIE
KESCGDPGTPLYGIREGDGFSNRDVLRFECQFGFELIGEKSIVCQENNQWSANIPICIFP
CLSNFTAPMGTVLSPDYPEGYGNNLNCIWTIISDPGSRIHLSFNDFDLESQFDFLAVKDG
DSPESPILGTFTGAEVPSHLTSNSHILRLEFQADHSMSGRGFNITYNTFGHNECPDPGIP
INARRFGDNFQLGSSISVICEEGFIKTQGTETITCILMDGKVMWSGLIPKCGAPCGGHFS
APSGVILSPGWPGYYKDSLNCEWVIEAEPGHSIKITFERFQTELNYDVLEVHDGPNLLSP
LLGSYNGTQVPQFLFSSSNFIYLLFTTDNSRSNNGFKIHYESVTVNTYSCLDPGIPVHGR
RYGHDFSIGSTVSFSCDSGYRLSHEEPLLCEKNHWWSHPLPTCDALCGGDVRGPSGTILS
PGYPEFYPNSLNCTWTVDVTHGKGVQFNFHTFHLEDHHDYLLITENGSFTQPLARLTGSD
LPPTINAGLYGNFRAQLRFISDFSISYEGFNITFSEYNLEPCEDPGIPQYGSRIGFNFGI
GDTLTFSCSSGYRLEGTSEIICLGGGRRVWSAPLPRCVAECGASATNNEGILLSPNYPLN
YENNHECIYSIQVQAGKGINISARTFHLAQGDVLKIYDGKDKTTHLLGAFTGASMRGLTL
SSTSNQLWLEFNSDTEGTDEGFQLVYTSFELSHCEDPGIPQFGYKISDQGHFAGSTIIYG
CNPGYTLHGSSLLKCMTGER

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E7EXI2	0.199	0.297	8.373E-49	898	0.149	0.233	E7EXI2.pdb.gz
2	AFDB:Q8CIZ5	0.090	0.090	4.422E-30	1418	0.118	0.116	Q8CIZ5.pdb.gz	DMBT1_RAT Deleted in malignant brain tumors 1 protein OS=Rattus norvegicus OX=10116 GN=Dmbt1 PE=1 SV=1
3	PDB:2gsxA	0.080	0.105	1.104E-23	951	0.138	0.203	2gsxA.pdb.gz
4	PDB:2q7zA	0.092	0.073	1.082E-22	1931	0.183	0.133	2q7zA.pdb.gz
5	AFDB:Q9BY79	0.129	0.261	2.011E-19	579	0.069	0.168	Q9BY79.pdb.gz	MFRP_HUMAN Membrane frizzled-related protein OS=Homo sapiens OX=9606 GN=MFRP PE=1 SV=1
6	AFDB:Q8K480	0.087	0.196	5.413E-18	584	0.063	0.151	Q8K480.pdb.gz	MFRP_MOUSE Membrane frizzled-related protein OS=Mus musculus OX=10090 GN=Mfrp PE=1 SV=1
7	AFDB:P98072	0.128	0.159	1.622E-17	1035	0.090	0.122	P98072.pdb.gz	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
8	AFDB:P98073	0.115	0.138	2.871E-17	1019	0.079	0.108	P98073.pdb.gz	ENTK_HUMAN Enteropeptidase OS=Homo sapiens OX=9606 GN=TMPRSS15 PE=1 SV=3
9	PDB:1haqA	0.064	0.072	2.171E-15	1213	0.136	0.157	1haqA.pdb.gz
10	AFDB:G4LU05	0.079	0.129	5.707E-14	822	0.074	0.127	G4LU05.pdb.gz	G4LU05_DROME Neuropilin and tolloid-like, isoform B OS=Drosophila melanogaster OX=7227 GN=Neto PE=2 SV=1
11	AFDB:O45419	0.078	0.278	5.707E-14	386	0.040	0.145	O45419.pdb.gz	O45419_CAEEL C-type lectin domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=clec-264 PE=1 SV=2
12	PDB:4bxsV	0.053	0.058	5.065E-9	1262	0.079	0.088	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
13	AFDB:Q86SQ4	0.077	0.087	5.645E-9	1221	0.065	0.075	Q86SQ4.pdb.gz	AGRG6_HUMAN Adhesion G-protein coupled receptor G6 OS=Homo sapiens OX=9606 GN=ADGRG6 PE=1 SV=3
14	AFDB:Q6F3F9	0.075	0.090	9.989E-9	1165	0.062	0.075	Q6F3F9.pdb.gz	AGRG6_MOUSE Adhesion G-protein coupled receptor G6 OS=Mus musculus OX=10090 GN=Adgrg6 PE=1 SV=1
15	PDB:1c1zA	0.065	0.218	5.666E-8	326	0.041	0.175	1c1zA.pdb.gz
16	PDB:8a7eC	0.089	0.086	3.004E-7	1524	0.066	0.060	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
17	PDB:7kveB	0.050	0.050	7.229E-7	1374	0.089	0.090	7kveB.pdb.gz
18	PDB:7b01A	0.066	0.147	4.774E-6	588	0.029	0.068	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
19	PDB:2uxtA	0.046	0.130	1.310E-5	422	0.038	0.126	2uxtA.pdb.gz
20	PDB:2xwbF	0.045	0.084	1.705E-5	714	0.039	0.077	2xwbF.pdb.gz	Structures of C3B in Complex with Factors B and D Give Insight Into Complement Convertase Formation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80T79	0.0	2806	3707	0.972	0.367	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
2	Q923L3	0.0	1418	3564	0.467	0.184	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
3	Q96PZ7	0.0	1420	3564	0.470	0.185	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
4	Q9Y6L7	3.34e-53	206	1015	0.123	0.169	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
5	Q9WVM6	2.03e-51	200	1012	0.121	0.168	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
6	Q62381	1.12e-49	194	1013	0.093	0.128	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
7	F1REM3	1.13e-49	194	976	0.099	0.141	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2
8	Q9BYH1	1.65e-49	194	1024	0.138	0.188	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1
9	O43897	1.84e-49	194	1013	0.094	0.130	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
10	O57460	3.44e-49	193	1022	0.104	0.143	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
11	Q8JI28	3.55e-49	193	1007	0.096	0.133	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
12	F1M798	1.17e-48	191	990	0.096	0.135	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
13	P98063	1.46e-48	191	991	0.096	0.135	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
14	Q2ABP1	1.80e-48	191	986	0.099	0.140	Q2ABP1_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=2 SV=1
15	P13497	2.00e-48	191	986	0.096	0.136	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
16	Q4V9Z5	3.96e-47	186	910	0.099	0.152	SE6L2_MOUSE Seizure 6-like protein 2 OS=Mus musculus OX=10090 GN=Sez6l2 PE=1 SV=1
17	Q7TSK2	7.26e-47	186	991	0.106	0.150	SEZ6_MOUSE Seizure protein 6 OS=Mus musculus OX=10090 GN=Sez6 PE=1 SV=1
18	Q53EL9	4.36e-46	183	994	0.111	0.156	SEZ6_HUMAN Seizure protein 6 homolog OS=Homo sapiens OX=9606 GN=SEZ6 PE=1 SV=2
19	Q6P1D5	6.85e-46	182	963	0.136	0.197	SE6L1_MOUSE Seizure 6-like protein OS=Mus musculus OX=10090 GN=Sez6l PE=1 SV=1
20	O70244	2.58e-41	169	3623	0.214	0.083	CUBN_RAT Cubilin OS=Rattus norvegicus OX=10116 GN=Cubn PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	1.8e-166	554.7	CUB domain
2	PF12079 DUF3558	37	15.7	Protein of unknown function (DUF3558)
3	PF00084 Sushi	7e-52	185.1	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000297405

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000262219	0.810	Annexin A13
2	9606.ENSP00000379065	0.774	Zinc finger transcription factor Trps1
3	9606.ENSP00000373610	0.696	Otoancorin
4	9606.ENSP00000256538	0.695	Diphthine--ammonia ligase
5	9606.ENSP00000280758	0.694	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11
6	9606.ENSP00000314709	0.694	Zinc fingers and homeoboxes protein 2
7	9606.ENSP00000344996	0.693	Paralemmin-3
8	9606.ENSP00000353516	0.688	Olfactory receptor 2W3
9	9606.ENSP00000414237	0.686	Integrator complex subunit 2
10	9606.ENSP00000276659	0.684	R-spondin-2
11	9606.ENSP00000386213	0.682	Myosin-IIIb
12	9606.ENSP00000280295	0.680	Protein phosphatase 1 regulatory subunit 1C
13	9606.ENSP00000374135	0.666	Low-density lipoprotein receptor-related protein 1B
14	9606.ENSP00000367446	0.643	Exostosin-1
15	9606.ENSP00000356669	0.642	Roquin-1
16	9606.ENSP00000282020	0.618	Glutamate receptor ionotropic, delta-2
17	9606.ENSP00000287020	0.609	Growth/differentiation factor 6
18	9606.ENSP00000331087	0.601	Protein TSSC4
19	9606.ENSP00000318607	0.594	Low-density lipoprotein receptor class A domain-containing protein 3
20	9606.ENSP00000432586	0.583	Protocadherin Fat 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.965	biological regulation
GO:0050789	0.963	regulation of biological process
GO:0050794	0.945	regulation of cellular process
GO:0031344	0.779	regulation of cell projection organization
GO:0050773	0.706	regulation of dendrite development
GO:0009987	0.380	cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016020	0.998	membrane
GO:0071944	0.987	cell periphery
GO:0005886	0.967	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]