StarFunc result for job id Q7Z408

User Input

>input (1400 residues)
MRLISIAPGPRWQVQSHHPRSAGQNCTFQLHGPNGTVESPGFPYGYPNYANCTWTITAEE
QHRIQLVFQSFALEEDFDVLSVFDGPPQPENLRTRLTGFQLPATIVSAATTLSLRLISDY
AVSAQGFHATYEVLPSHTCGNPGRLPNGIQQGSTFNLGDKVRYSCNLGFFLEGHAVLTCH
AGSENSATWDFPLPSCRADDACGGTLRGQSGIISSPHFPSEYHNNADCTWTILAELGDTI
ALVFIDFQLEDGYDFLEVTGTEGSSLWFTGASLPAPVISSKNWLRLHFTSDGNHRQRGFS
AQYQVKKQIELKSRGVKLMPSKDNSQKTSVLTQVGVSQGHNMCPDPGIPERGKRLGSDFR
LGSSVQFTCNEGYDLQGSKRITCMKVSDMFAAWSDHRPVCRARMCDAHLRGPSGIITSPN
FPIQYDNNAHCVWIITALNPSKVIKLAFEEFDLERGYDTLTVGDGGQDGDQKTVLYILTG
TSVPDLIVSTNHQMWLLFQTDGSGSSLGFKASYEEIEQGSCGDPGIPAYGRREGSRFHHG
DTLKFECQPAFELVGQKAITCQKNNQWSAKKPGCVFSCFFNFTSPSGVVLSPNYPEDYGN
HLHCVWLILARPESRIHLAFNDIDVEPQFDFLVIKDGATAEAPVLGTFSGNQLPSSITSS
GHVARLEFQTDHSTGKRGFNITFTTFRHNECPDPGVPVNGKRFGDSLQLGSSISFLCDEG
FLGTQGSETITCVLKEGSVVWNSAVLRCEAPCGGHLTSPSGTILSPGWPGFYKDALSCAW
VIEAQPGYPIKITFDRFKTEVNYDTLEVRDGRTYSAPLIGVYHGTQVPQFLISTSNYLYL
LFSTDKSHSDIGFQLRYETITLQSDHCLDPGIPVNGQRHGNDFYVGALVTFSCDSGYTLS
DGEPLECEPNFQWSRALPSCEALCGGFIQGSSGTILSPGFPDFYPNNLNCTWIIETSHGK
GVFFTFHTFHLESGHDYLLITENGSFTQPLRQLTGSRLPAPISAGLYGNFTAQVRFISDF
SMSYEGFNITFSEYDLEPCEEPEVPAYSIRKGLQFGVGDTLTFSCFPGYRLEGTARITCL
GGRRRLWSSPLPRCVAECGNSVTGTQGTLLSPNFPVNYNNNHECIYSIQTQPGKGIQLKA
RAFELSEGDVLKVYDGNNNSARLLGVFSHSEMMGVTLNSTSSSLWLDFITDAENTSKGFE
LHFSSFELIKCEDPGTPKFGYKVHDEGHFAGSSVSFSCDPGYSLRGSEELLCLSGERRTW
DRPLPTCVAECGGTVRGEVSGQVLSPGYPAPYEHNLNCIWTIEAEAGCTIGLHFLVFDTE
EVHDVLRIWDGPVESGVLLKELSGPALPKDLHSTFNSVVLQFSTDFFTSKQGFAIQFSVS
TATSCNDPGIPQNGSRSGDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:O43897	0.107	0.134	2.420E-50	1013	0.139	0.192	O43897.pdb.gz	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
2	AFDB:P98063	0.118	0.155	7.155E-50	991	0.146	0.207	P98063.pdb.gz	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
3	AFDB:Q8JI28	0.119	0.149	3.559E-49	1007	0.139	0.193	Q8JI28.pdb.gz	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
4	AFDB:O57460	0.118	0.150	4.053E-49	1022	0.144	0.198	O57460.pdb.gz	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
5	AFDB:A0A2R8QEK5	0.113	0.146	1.307E-48	986	0.146	0.208	A0A2R8QEK5.pdb.gz
6	AFDB:E7EXI2	0.227	0.338	2.504E-48	898	0.141	0.220	E7EXI2.pdb.gz
7	AFDB:Q9Y6L7	0.093	0.124	2.852E-48	1015	0.133	0.183	Q9Y6L7.pdb.gz	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
8	AFDB:Q60997	0.117	0.087	1.047E-47	2085	0.166	0.111	Q60997.pdb.gz	DMBT1_MOUSE Deleted in malignant brain tumors 1 protein OS=Mus musculus OX=10090 GN=Dmbt1 PE=1 SV=2
9	AFDB:Q53EL9	0.229	0.312	6.756E-47	994	0.139	0.196	Q53EL9.pdb.gz	SEZ6_HUMAN Seizure protein 6 homolog OS=Homo sapiens OX=9606 GN=SEZ6 PE=1 SV=2
10	AFDB:Q6P1D5	0.226	0.315	1.608E-46	963	0.145	0.211	Q6P1D5.pdb.gz	SE6L1_MOUSE Seizure 6-like protein OS=Mus musculus OX=10090 GN=Sez6l PE=1 SV=1
11	PDB:2gsxA	0.077	0.104	9.670E-28	951	0.134	0.197	2gsxA.pdb.gz
12	PDB:2q7zA	0.068	0.056	8.054E-26	1931	0.154	0.111	2q7zA.pdb.gz
13	PDB:1haqA	0.068	0.073	3.121E-18	1213	0.131	0.152	1haqA.pdb.gz
14	PDB:4bxsV	0.067	0.071	5.814E-12	1262	0.081	0.090	4bxsV.pdb.gz	Crystal Structure of the Prothrombinase Complex from the Venom of Pseudonaja Textilis.
15	PDB:1c1zA	0.057	0.198	4.616E-9	326	0.047	0.202	1c1zA.pdb.gz
16	PDB:8a7eC	0.079	0.074	7.121E-9	1524	0.080	0.073	8a7eC.pdb.gz	Structure of the proteolytic enzyme PAPP-A with the endogenous inhibitor stanniocalcin-2 reveals its inhibitory mechanism.
17	PDB:7kveB	0.066	0.066	1.930E-8	1374	0.096	0.098	7kveB.pdb.gz
18	PDB:5n4lA	0.060	0.073	5.931E-7	1034	0.060	0.081	5n4lA.pdb.gz	Rat ceruloplasmin: a new labile copper binding site and zinc/copper mosaic.
19	PDB:7b01A	0.068	0.151	2.178E-6	588	0.030	0.071	7b01A.pdb.gz	Crystal structure of ADAMTS13 CUB domains reveals their role in global latency.
20	PDB:1kcwA	0.057	0.071	5.653E-6	1017	0.061	0.084	1kcwA.pdb.gz	The X-ray structure of human serum ceruloplasmin at 3.1 angstrom: Nature of the copper centres.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q80T79	0.0	1536	3707	0.497	0.188	CSMD3_MOUSE CUB and sushi domain-containing protein 3 OS=Mus musculus OX=10090 GN=Csmd3 PE=1 SV=3
2	Q923L3	0.0	2085	3564	0.683	0.268	CSMD1_MOUSE CUB and sushi domain-containing protein 1 OS=Mus musculus OX=10090 GN=Csmd1 PE=1 SV=2
3	Q96PZ7	0.0	2073	3564	0.679	0.267	CSMD1_HUMAN CUB and sushi domain-containing protein 1 OS=Homo sapiens OX=9606 GN=CSMD1 PE=1 SV=3
4	F1REM3	1.25e-56	216	976	0.129	0.185	F1REM3_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=4 SV=2
5	O43897	1.65e-55	213	1013	0.136	0.189	TLL1_HUMAN Tolloid-like protein 1 OS=Homo sapiens OX=9606 GN=TLL1 PE=1 SV=1
6	Q2ABP1	2.27e-55	212	986	0.129	0.184	Q2ABP1_DANRE Metalloendopeptidase OS=Danio rerio OX=7955 GN=bmp1a PE=2 SV=1
7	Q62381	9.32e-55	211	1013	0.134	0.186	TLL1_MOUSE Tolloid-like protein 1 OS=Mus musculus OX=10090 GN=Tll1 PE=1 SV=1
8	Q8JI28	9.53e-53	204	1007	0.131	0.182	TLL1_XENLA Tolloid-like protein 1 OS=Xenopus laevis OX=8355 GN=tll1 PE=1 SV=1
9	Q7TSK2	2.81e-52	202	991	0.142	0.201	SEZ6_MOUSE Seizure protein 6 OS=Mus musculus OX=10090 GN=Sez6 PE=1 SV=1
10	O57460	1.08e-51	201	1022	0.131	0.179	TLL1_DANRE Dorsal-ventral patterning tolloid-like protein 1 OS=Danio rerio OX=7955 GN=tll1 PE=2 SV=1
11	F1M798	4.71e-51	199	990	0.099	0.140	F1M798_RAT Metalloendopeptidase OS=Rattus norvegicus OX=10116 GN=Bmp1 PE=4 SV=2
12	P98063	6.27e-51	198	991	0.100	0.141	BMP1_MOUSE Bone morphogenetic protein 1 OS=Mus musculus OX=10090 GN=Bmp1 PE=1 SV=2
13	Q53EL9	1.11e-50	197	994	0.142	0.200	SEZ6_HUMAN Seizure protein 6 homolog OS=Homo sapiens OX=9606 GN=SEZ6 PE=1 SV=2
14	Q9WVM6	1.53e-50	197	1012	0.155	0.214	TLL2_MOUSE Tolloid-like protein 2 OS=Mus musculus OX=10090 GN=Tll2 PE=1 SV=1
15	P13497	1.59e-50	197	986	0.099	0.141	BMP1_HUMAN Bone morphogenetic protein 1 OS=Homo sapiens OX=9606 GN=BMP1 PE=1 SV=2
16	Q9Y6L7	2.07e-48	191	1015	0.127	0.175	TLL2_HUMAN Tolloid-like protein 2 OS=Homo sapiens OX=9606 GN=TLL2 PE=1 SV=1
17	Q9BYH1	4.21e-46	183	1024	0.110	0.150	SE6L1_HUMAN Seizure 6-like protein OS=Homo sapiens OX=9606 GN=SEZ6L PE=1 SV=1
18	Q9TU53	3.59e-45	182	3620	0.198	0.077	CUBN_CANLF Cubilin OS=Canis lupus familiaris OX=9615 GN=CUBN PE=1 SV=1
19	Q4V9Z5	4.88e-45	179	910	0.136	0.209	SE6L2_MOUSE Seizure 6-like protein 2 OS=Mus musculus OX=10090 GN=Sez6l2 PE=1 SV=1
20	Q6P1D5	5.51e-43	173	963	0.101	0.147	SE6L1_MOUSE Seizure 6-like protein OS=Mus musculus OX=10090 GN=Sez6l PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00431 CUB	1e-182	606.9	CUB domain
2	PF00084 Sushi	1.4e-59	209.7	Sushi repeat (SCR repeat)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008963241.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003805363.1	0.700	Farnesyl-diphosphate farnesyltransferase 1
2	9597.XP_003807959.1	0.690	Src kinase associated phosphoprotein 2
3	9597.XP_008968041.1	0.679	Belongs to the peptidase C1 family.
4	9597.XP_008962319.1	0.664	Adhesion G protein-coupled receptor L3
5	9597.XP_003816240.1	0.567	Potassium channel tetramerization domain containing 15
6	9597.XP_008967358.1	0.526	Belongs to the peptidase A1 family.
7	9597.XP_003812597.1	0.512	High mobility group box 4
8	9597.XP_008953976.1	0.505	Potassium channel tetramerization domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.653	developmental process
GO:0065007	0.584	biological regulation
GO:0050789	0.532	regulation of biological process
GO:0032501	0.492	multicellular organismal process
GO:0048856	0.472	anatomical structure development
GO:0050794	0.376	regulation of cellular process
GO:0007275	0.348	multicellular organism development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0016020	0.982	membrane
GO:0005886	0.919	plasma membrane
GO:0005576	0.316	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]