StarFunc result for job id Q7Z410

User Input

>input (1059 residues)
MEPTVADVHLVPRTTKEVPALDAACCRAASIGVVATSLVVLTLGVLLAFLSTQGFHVDHT
AELRGIRWTSSLRRETSDYHRTLTPTLEALLHFLLRPLQTLSLGLEEELLQRGIRARLRE
HGISLAAYGTIVSAELTGRHKGPLAERDFKSGRCPGNSFSCGNSQCVTKVNPECDDQEDC
SDGSDEAHCECGLQPAWRMAGRIVGGMEASPGEFPWQASLRENKEHFCGAAIINARWLVS
AAHCFNEFQDPTKWVAYVGATYLSGSEASTVRAQVVQIVKHPLYNADTADFDVAVLELTS
PLPFGRHIQPVCLPAATHIFPPSKKCLISGWGYLKEDFLVKPEVLQKATVELLDQALCAS
LYGHSLTDRMVCAGYLDGKVDSCQGDSGGPLVCEEPSGRFFLAGIVSWGIGCAEARRPGV
YARVTRLRDWILEATTKASMPLAPTMAPAPAAPSTAWPTSPESPVVSTPTKSMQALSTVP
LDWVTVPKLQECGARPAMEKPTRVVGGFGAASGEVPWQVSLKEGSRHFCGATVVGDRWLL
SAAHCFNHTKVEQVRAHLGTASLLGLGGSPVKIGLRRVVLHPLYNPGILDFDLAVLELAS
PLAFNKYIQPVCLPLAIQKFPVGRKCMISGWGNTQEGNATKPELLQKASVGIIDQKTCSV
LYNFSLTDRMICAGFLEGKVDSCQGDSGGPLACEEAPGVFYLAGIVSWGIGCAQVKKPGV
YTRITRLKGWILEIMSSQPLPMSPPSTTRMLATTSPRTTAGLTVPGATPSRPTPGAASRV
TGQPANSTLSAVSTTARGQTPFPDAPEATTHTQLPDCGLAPAALTRIVGGSAAGRGEWPW
QVSLWLRRREHRCGAVLVAERWLLSAAHCFDVYGDPKQWAAFLGTPFLSGAEGQLERVAR
IYKHPFYNLYTLDYDVALLELAGPVRRSRLVRPICLPEPAPRPPDGTRCVITGWGSVREG
GSMARQLQKAAVRLLSEQTCRRFYPVQISSRMLCAGFPQGGVDSCSGDAGGPLACREPSG
RWVLTGVTSWGYGCGRPHFPGVYTRVAAVRGWIGQHIQE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P69525	0.331	0.329	0.000	1065	0.796	0.792	P69525.pdb.gz	TMPS9_MOUSE Transmembrane protease serine 9 OS=Mus musculus OX=10090 GN=Tmprss9 PE=3 SV=1
2	AFDB:Q5K4E3	0.225	0.276	3.135E-54	855	0.232	0.288	Q5K4E3.pdb.gz	POLS2_HUMAN Polyserase-2 OS=Homo sapiens OX=9606 GN=PRSS36 PE=1 SV=2
3	AFDB:Q5K2P8	0.224	0.279	1.328E-53	849	0.217	0.271	Q5K2P8.pdb.gz	POLS2_MOUSE Polyserase-2 OS=Mus musculus OX=10090 GN=Prss36 PE=2 SV=1
4	AFDB:Q2L4Q9	0.216	0.403	1.647E-39	553	0.146	0.280	Q2L4Q9.pdb.gz	PRS53_HUMAN Serine protease 53 OS=Homo sapiens OX=9606 GN=PRSS53 PE=1 SV=1
5	AFDB:Q9DBI0	0.260	0.339	2.261E-38	811	0.128	0.168	Q9DBI0.pdb.gz	TMPS6_MOUSE Transmembrane protease serine 6 OS=Mus musculus OX=10090 GN=Tmprss6 PE=1 SV=4
6	AFDB:Q8IU80	0.260	0.339	2.024E-37	811	0.123	0.160	Q8IU80.pdb.gz	TMPS6_HUMAN Transmembrane protease serine 6 OS=Homo sapiens OX=9606 GN=TMPRSS6 PE=1 SV=3
7	AFDB:P56677	0.262	0.324	2.634E-36	855	0.123	0.152	P56677.pdb.gz	ST14_MOUSE Suppressor of tumorigenicity 14 protein homolog OS=Mus musculus OX=10090 GN=St14 PE=1 SV=2
8	AFDB:A5PMY0	0.257	0.326	9.989E-35	834	0.132	0.168	A5PMY0.pdb.gz	A5PMY0_DANRE Suppressor of tumorigenicity 14 protein homolog OS=Danio rerio OX=7955 GN=st14 PE=1 SV=1
9	AFDB:P98072	0.233	0.238	2.748E-33	1035	0.185	0.189	P98072.pdb.gz	ENTK_BOVIN Enteropeptidase OS=Bos taurus OX=9913 GN=TMPRSS15 PE=1 SV=1
10	AFDB:Q8BIK6	0.255	0.324	6.465E-33	829	0.119	0.152	Q8BIK6.pdb.gz	TMPS7_MOUSE Transmembrane protease serine 7 OS=Mus musculus OX=10090 GN=Tmprss7 PE=1 SV=3
11	PDB:1cgiE	0.211	0.886	5.503E-26	245	0.085	0.367	1cgiE.pdb.gz
12	PDB:1fiwA	0.215	0.851	8.001E-26	260	0.085	0.346	1fiwA.pdb.gz	Effector sites in the three-dimensional structure of mammalian sperm beta-acrosin.
13	PDB:4bnrA	0.210	0.909	2.210E-25	237	0.087	0.388	4bnrA.pdb.gz	Comparison of Complexes Formed by a Crustacean and a Vertebrate Trypsin with Bovine Pancreatic Trypsin Inhibitor - the Key to Achieving Extreme Stability?
14	PDB:6i44A	0.209	0.369	5.483E-25	594	0.087	0.155	6i44A.pdb.gz	Plasma kallikrein structure reveals apple domain disc rotated conformation compared to factor XI.
15	PDB:2a31A	0.205	0.950	7.972E-25	223	0.082	0.390	2a31A.pdb.gz	NMR and crystallographic characterization of adventitious borate binding by trypsin.
16	PDB:2ra3A	0.207	0.952	3.757E-24	224	0.080	0.379	2ra3A.pdb.gz	Structural Basis for Accelerated Cleavage of Bovine Pancreatic Trypsin Inhibitor (BPTI) by Human Mesotrypsin.
17	PDB:4h4fA	0.212	0.912	1.285E-23	239	0.076	0.339	4h4fA.pdb.gz	Long-range Electrostatic Complementarity Governs Substrate Recognition by Human Chymotrypsin C, a Key Regulator of Digestive Enzyme Activation.
18	PDB:1a0lA	0.206	0.863	1.868E-23	244	0.086	0.373	1a0lA.pdb.gz	Human beta-tryptase is a ring-like tetramer with active sites facing a central pore.
19	PDB:4q7xA	0.211	0.922	2.865E-23	235	0.073	0.328	4q7xA.pdb.gz
20	PDB:1tgsZ	0.204	0.924	3.743E-23	225	0.083	0.391	1tgsZ.pdb.gz	Three-dimensional structure of the complex between pancreatic secretory trypsin inhibitor (Kazal type) and trypsinogen at 1.8 A resolution. Structure solution, crystallographic refinement and preliminary structural interpretation.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P69525	0.0	1691	1065	0.798	0.793	TMPS9_MOUSE Transmembrane protease serine 9 OS=Mus musculus OX=10090 GN=Tmprss9 PE=3 SV=1
2	Q9DBI0	5.57e-81	283	811	0.129	0.169	TMPS6_MOUSE Transmembrane protease serine 6 OS=Mus musculus OX=10090 GN=Tmprss6 PE=1 SV=4
3	A0A8I6AEJ8	9.29e-77	271	820	0.126	0.162	A0A8I6AEJ8_RAT ST14 transmembrane serine protease matriptase OS=Rattus norvegicus OX=10116 GN=St14 PE=4 SV=1
4	Q1RLP8	1.38e-76	271	827	0.132	0.169	Q1RLP8_DANRE Suppressor of tumorigenicity 14 protein homolog OS=Danio rerio OX=7955 GN=st14a PE=2 SV=1
5	A5PMY0	1.72e-76	271	834	0.132	0.168	A5PMY0_DANRE Suppressor of tumorigenicity 14 protein homolog OS=Danio rerio OX=7955 GN=st14 PE=1 SV=1
6	Q9Y5Y6	2.51e-76	271	855	0.125	0.154	ST14_HUMAN Suppressor of tumorigenicity 14 protein OS=Homo sapiens OX=9606 GN=ST14 PE=1 SV=2
7	Q8IU80	4.28e-76	270	811	0.124	0.162	TMPS6_HUMAN Transmembrane protease serine 6 OS=Homo sapiens OX=9606 GN=TMPRSS6 PE=1 SV=3
8	Q9JJI7	4.41e-76	270	855	0.126	0.156	Q9JJI7_RAT Suppressor of tumorigenicity 14 protein homolog OS=Rattus norvegicus OX=10116 GN=St14 PE=1 SV=1
9	A0A8I6ARC9	4.68e-76	270	846	0.126	0.157	A0A8I6ARC9_RAT Suppressor of tumorigenicity 14 protein homolog OS=Rattus norvegicus OX=10116 GN=St14 PE=3 SV=1
10	P56677	1.95e-75	268	855	0.126	0.156	ST14_MOUSE Suppressor of tumorigenicity 14 protein homolog OS=Mus musculus OX=10090 GN=St14 PE=1 SV=2
11	Q8BIK6	4.01e-64	235	829	0.126	0.160	TMPS7_MOUSE Transmembrane protease serine 7 OS=Mus musculus OX=10090 GN=Tmprss7 PE=1 SV=3
12	Q9UL52	1.49e-61	218	423	0.106	0.265	TM11E_HUMAN Transmembrane protease serine 11E OS=Homo sapiens OX=9606 GN=TMPRSS11E PE=1 SV=2
13	Q1JRP2	4.15e-61	217	431	0.108	0.265	TM11C_MOUSE Transmembrane protease serine 11C OS=Mus musculus OX=10090 GN=Tmprss11c PE=1 SV=1
14	Q9ER04	1.03e-58	211	455	0.106	0.246	TMPS5_MOUSE Transmembrane protease serine 5 OS=Mus musculus OX=10090 GN=Tmprss5 PE=2 SV=3
15	Q9H3S3	1.50e-57	207	457	0.105	0.243	TMPS5_HUMAN Transmembrane protease serine 5 OS=Homo sapiens OX=9606 GN=TMPRSS5 PE=1 SV=2
16	Q8VHJ4	1.58e-57	206	417	0.125	0.317	TM11D_RAT Transmembrane protease serine 11D OS=Rattus norvegicus OX=10116 GN=Tmprss11d PE=2 SV=1
17	Q5QSK2	4.86e-57	205	417	0.093	0.237	TM11G_RAT Transmembrane protease serine 11G OS=Rattus norvegicus OX=10116 GN=Tmprss11g PE=2 SV=1
18	Q8VHK8	8.43e-57	204	417	0.121	0.307	TM11D_MOUSE Transmembrane protease serine 11D OS=Mus musculus OX=10090 GN=Tmprss11d PE=1 SV=2
19	Q5S248	2.92e-56	203	423	0.094	0.236	TM11E_MOUSE Transmembrane protease serine 11E OS=Mus musculus OX=10090 GN=Tmprss11e PE=1 SV=2
20	O60235	2.49e-55	200	418	0.127	0.323	TM11D_HUMAN Transmembrane protease serine 11D OS=Homo sapiens OX=9606 GN=TMPRSS11D PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF09342 DUF1986	7.6e-13	60.3	Domain of unknown function (DUF1986)
2	PF00057 Ldl_recept_a	0.00099	30.6	Low-density lipoprotein receptor domain class A
3	PF00089 Trypsin	2e-201	677.0	Trypsin
4	PF13365 Trypsin_2	7.6e-11	54.7	Trypsin-like peptidase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000330264

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000215570	0.730	Mitochondrial import inner membrane translocase subunit Tim13
2	9606.ENSP00000474071	0.726	Coiled-coil domain-containing protein 120
3	9606.ENSP00000371419	0.616	poly(ADP-ribose) polymerase family member 4
4	9606.ENSP00000329117	0.614	APC membrane recruitment protein 1
5	9606.ENSP00000252463	0.575	Zinc finger and SCAN domain-containing protein 10
6	9606.ENSP00000349932	0.523	Receptor-type tyrosine-protein phosphatase S

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0008236	1.000	serine-type peptidase activity
GO:0005488	0.987	binding
GO:0005515	0.973	protein binding
GO:0004175	0.943	endopeptidase activity
GO:0004252	0.934	serine-type endopeptidase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0044238	0.991	primary metabolic process
GO:1901564	0.991	organonitrogen compound metabolic process
GO:0019538	0.970	protein metabolic process
GO:0006508	0.953	proteolysis
GO:0031638	0.680	zymogen activation
GO:0065007	0.577	biological regulation
GO:0009987	0.523	cellular process
GO:0050789	0.341	regulation of biological process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.996	cellular anatomical entity
GO:0016020	0.994	membrane
GO:0043226	0.985	organelle
GO:0005622	0.983	intracellular anatomical structure
GO:0071944	0.981	cell periphery
GO:0005886	0.974	plasma membrane
GO:0043227	0.961	membrane-bounded organelle
GO:0043229	0.945	intracellular organelle
GO:0005576	0.936	extracellular region
GO:0005737	0.903	cytoplasm
GO:0005615	0.794	extracellular space
GO:0070062	0.619	extracellular exosome
GO:0043231	0.606	intracellular membrane-bounded organelle
GO:0070013	0.505	intracellular organelle lumen
GO:0032991	0.365	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.4.-.-	1.000	Acting on peptide bonds (peptidases).
EC:3.4.21.-	0.934	Serine endopeptidases.

[back to server]