StarFunc result for job id Q7Z429

User Input

>input (371 residues)
MSHEKSFLVSGDNYPPPNPGYPGGPQPPMPPYAQPPYPGAPYPQPPFQPSPYGQPGYPHG
PSPYPQGGYPQGPYPQGGYPQGPYPQEGYPQGPYPQGGYPQGPYPQSPFPPNPYGQPQVF
PGQDPDSPQHGNYQEEGPPSYYDNQDFPATNWDDKSIRQAFIRKVFLVLTLQLSVTLSTV
SVFTFVAEVKGFVRENVWTYYVSYAVFFISLIVLSCCGDFRRKHPWNLVALSVLTASLSY
MVGMIASFYNTEAVIMAVGITTAVCFTVVIFSMQTRYDFTSCMGVLLVSMVVLFIFAILC
IFIRNRILEIVYASLGALLFTCFLAVDTQLLLGNKQLSLSPEEYVFAALNLYTDIINIFL
YILTIIGRAKE

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z429	1.000	1.000	2.174E-42	371	1.000	1.000	Q7Z429.pdb.gz	LFG1_HUMAN Protein lifeguard 1 OS=Homo sapiens OX=9606 GN=GRINA PE=1 SV=1
2	AFDB:A0A0R4IG88	0.625	0.638	6.871E-29	363	0.650	0.664	A0A0R4IG88.pdb.gz
3	AFDB:Q8BJZ3	0.560	0.669	3.454E-18	309	0.356	0.427	Q8BJZ3.pdb.gz	LFG3_MOUSE Protein lifeguard 3 OS=Mus musculus OX=10090 GN=Tmbim1 PE=1 SV=1
4	AFDB:Q8K097	0.570	0.663	8.561E-18	317	0.345	0.404	Q8K097.pdb.gz	LFG2_MOUSE Protein lifeguard 2 OS=Mus musculus OX=10090 GN=Faim2 PE=2 SV=1
5	AFDB:Q9VFM3	0.580	0.808	1.151E-15	264	0.272	0.383	Q9VFM3.pdb.gz	Q9VFM3_DROME IP10175p OS=Drosophila melanogaster OX=7227 GN=Recs1 PE=2 SV=1
6	AFDB:G3XAA5	0.532	0.689	1.836E-10	285	0.183	0.239	G3XAA5.pdb.gz	G3XAA5_HUMAN Transmembrane BAX inhibitor motif containing 4 OS=Homo sapiens OX=9606 GN=TMBIM4 PE=3 SV=3
7	AFDB:F4JIE8	0.516	0.794	1.180E-9	235	0.173	0.272	F4JIE8.pdb.gz	LFG1_ARATH Protein LIFEGUARD 1 OS=Arabidopsis thaliana OX=3702 GN=LFG1 PE=2 SV=1
8	AFDB:Q9M1V9	0.532	0.808	1.857E-9	239	0.151	0.234	Q9M1V9.pdb.gz	LFG2_ARATH Protein LIFEGUARD 2 OS=Arabidopsis thaliana OX=3702 GN=LFG2 PE=2 SV=1
9	AFDB:Q9ZQX7	0.532	0.782	1.857E-9	248	0.164	0.246	Q9ZQX7.pdb.gz	LFG3_ARATH Protein LIFEGUARD 3 OS=Arabidopsis thaliana OX=3702 GN=LFG3 PE=2 SV=1
10	AFDB:O59785	0.163	0.130	2.208E-2	505	0.146	0.107	O59785.pdb.gz	YCN8_SCHPO Uncharacterized solute carrier family 35 member C320.08 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPCC320.08 PE=1 SV=1
11	PDB:3egwC	0.158	0.222	2.568E-1	225	0.070	0.116	3egwC.pdb.gz	When width is more important than height: Barriers to electron transfer in E.coli nitrate reductase
12	PDB:7finR	0.171	0.168	3.079E-1	380	0.094	0.092	7finR.pdb.gz	Structural insights into multiplexed pharmacological actions of tirzepatide and peptide 20 at the GIP, GLP-1 or glucagon receptors.
13	PDB:6xz4A	0.142	0.164	3.528E-1	304	0.102	0.125	6xz4A.pdb.gz
14	PDB:6wpwR	0.146	0.138	3.863E-1	398	0.073	0.068	6wpwR.pdb.gz	Structural insights into differences in G protein activation by family A and family B GPCRs.
15	PDB:7tynR	0.169	0.169	5.812E-1	373	0.065	0.064	7tynR.pdb.gz	A structural basis for amylin receptor phenotype.
16	PDB:7lciR	0.132	0.126	7.985E-1	393	0.070	0.066	7lciR.pdb.gz	Evolving cryo-EM structural approaches for GPCR drug discovery.
17	PDB:4iggB	0.095	0.054	8.356E-1	771	0.084	0.040	4iggB.pdb.gz
18	PDB:7y12R	0.124	0.163	1.048	264	0.078	0.110	7y12R.pdb.gz	Structural insight into the activation mechanism of MrgD with heterotrimeric Gi-protein revealed by cryo-EM.
19	PDB:4qtnC	0.154	0.210	1.148	237	0.065	0.101	4qtnC.pdb.gz	Crystal structure of the Vitamin B3 transporter PnuC
20	PDB:6osaR	0.153	0.167	1.201	321	0.105	0.121	6osaR.pdb.gz	Conformational transitions of a neurotensin receptor 1-Gi1complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z429	0.0	744	371	1.000	1.000	LFG1_HUMAN Protein lifeguard 1 OS=Homo sapiens OX=9606 GN=GRINA PE=1 SV=1
2	Q9ESF4	0.0	592	345	0.873	0.939	LFG1_MOUSE Protein lifeguard 1 OS=Mus musculus OX=10090 GN=Grina PE=2 SV=1
3	Q1ECY6	1.77e-141	407	363	0.650	0.664	Q1ECY6_DANRE Protein lifeguard 1 OS=Danio rerio OX=7955 GN=si:ch1073-375m16.2 PE=2 SV=1
4	Q9BWQ8	8.11e-77	241	316	0.340	0.399	LFG2_HUMAN Protein lifeguard 2 OS=Homo sapiens OX=9606 GN=FAIM2 PE=1 SV=1
5	O88407	1.65e-75	238	316	0.353	0.415	LFG2_RAT Protein lifeguard 2 OS=Rattus norvegicus OX=10116 GN=Faim2 PE=2 SV=1
6	Q8K097	3.16e-73	232	317	0.342	0.401	LFG2_MOUSE Protein lifeguard 2 OS=Mus musculus OX=10090 GN=Faim2 PE=2 SV=1
7	Q1MW40	1.56e-67	217	311	0.348	0.415	Q1MW40_HUMAN Responsive to centrifugal force and shear stress gene 1 OS=Homo sapiens OX=9606 GN=RECS1 PE=2 SV=1
8	Q969X1	2.01e-67	217	311	0.348	0.415	LFG3_HUMAN Protein lifeguard 3 OS=Homo sapiens OX=9606 GN=TMBIM1 PE=1 SV=2
9	Q8BJZ3	1.20e-64	209	309	0.323	0.388	LFG3_MOUSE Protein lifeguard 3 OS=Mus musculus OX=10090 GN=Tmbim1 PE=1 SV=1
10	Q9VFM3	5.05e-53	178	264	0.264	0.371	Q9VFM3_DROME IP10175p OS=Drosophila melanogaster OX=7227 GN=Recs1 PE=2 SV=1
11	Q9DA39	1.26e-27	110	238	0.210	0.328	LFG4_MOUSE Protein lifeguard 4 OS=Mus musculus OX=10090 GN=Tmbim4 PE=2 SV=1
12	C9JWV9	1.13e-24	100	171	0.178	0.386	C9JWV9_HUMAN Transmembrane BAX inhibitor motif containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=TMBIM1 PE=1 SV=1
13	C9JW19	9.11e-24	98.6	167	0.175	0.389	C9JW19_HUMAN Transmembrane BAX inhibitor motif containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=TMBIM1 PE=1 SV=1
14	O74888	5.12e-21	93.6	266	0.213	0.297	BXI1_SCHPO Bax inhibitor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=bxi1 PE=3 SV=1
15	Q9HC24	8.11e-21	92.4	238	0.202	0.315	LFG4_HUMAN Protein lifeguard 4 OS=Homo sapiens OX=9606 GN=TMBIM4 PE=1 SV=3
16	G3XAA5	3.03e-19	89.0	285	0.194	0.253	G3XAA5_HUMAN Transmembrane BAX inhibitor motif containing 4 OS=Homo sapiens OX=9606 GN=TMBIM4 PE=3 SV=3
17	F4JIE8	8.00e-19	86.7	235	0.175	0.277	LFG1_ARATH Protein LIFEGUARD 1 OS=Arabidopsis thaliana OX=3702 GN=LFG1 PE=2 SV=1
18	C9IZ27	7.53e-16	76.3	150	0.154	0.380	C9IZ27_HUMAN Transmembrane BAX inhibitor motif containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=TMBIM1 PE=1 SV=8
19	Q9ZQX7	1.37e-15	77.8	248	0.173	0.258	LFG3_ARATH Protein LIFEGUARD 3 OS=Arabidopsis thaliana OX=3702 GN=LFG3 PE=2 SV=1
20	G2WLG4	3.69e-15	77.4	298	0.178	0.221	G2WLG4_YEASK K7_Ynl305cp OS=Saccharomyces cerevisiae (strain Kyokai no. 7 / NBRC 101557) OX=721032 GN=K7_YNL305C PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01027 Bax1-I	3.1e-31	120.3	Inhibitor of apoptosis-promoting Bax1

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000314380

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000348069	0.774	Sterol regulatory element-binding protein 1
2	9606.ENSP00000389277	0.773	Bax inhibitor 1
3	9606.ENSP00000220616	0.672	Thyroglobulin
4	9606.ENSP00000364349	0.636	Cyclic AMP-dependent transcription factor ATF-6 beta
5	9606.ENSP00000255266	0.635	Rod cGMP-specific 3',5'-cyclic phosphodiesterase subunit alpha
6	9606.ENSP00000436621	0.632	UPF0598 protein C8orf82
7	9606.ENSP00000387426	0.628	Cysteine and histidine rich 1
8	9606.ENSP00000378725	0.612	Kinectin
9	9606.ENSP00000354476	0.609	Sterol regulatory element-binding protein 2
10	9606.ENSP00000236273	0.607	Pre-mRNA-splicing factor SYF2
11	9606.ENSP00000324122	0.597	U4/U6 small nuclear ribonucleoprotein Prp31
12	9606.ENSP00000342805	0.596	Fas apoptotic inhibitory molecule 1
13	9606.ENSP00000366522	0.572	Rho GTPase activating protein 39
14	9606.ENSP00000435565	0.567	Maestro heat like repeat family member 1
15	9606.ENSP00000292539	0.537	Protein phosphatase 1 regulatory subunit 16A
16	9606.ENSP00000277458	0.530	Ankyrin repeat and SOCS box protein 6
17	9606.ENSP00000341625	0.522	Cytochrome b5
18	9606.ENSP00000348772	0.515	Membrane-associated phosphatidylinositol transfer protein 1
19	9606.ENSP00000342560	0.508	Histamine H3 receptor

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0065007	0.995	biological regulation
GO:0050794	0.983	regulation of cellular process
GO:0048519	0.955	negative regulation of biological process
GO:0009987	0.887	cellular process
GO:1905897	0.863	regulation of response to endoplasmic reticulum stress
GO:0048523	0.859	negative regulation of cellular process
GO:1903573	0.774	negative regulation of response to endoplasmic reticulum stress
GO:0023051	0.739	regulation of signaling
GO:0010646	0.739	regulation of cell communication
GO:0048878	0.702	chemical homeostasis
GO:0042981	0.638	regulation of apoptotic process
GO:0009966	0.632	regulation of signal transduction
GO:0050801	0.631	monoatomic ion homeostasis
GO:0098771	0.608	inorganic ion homeostasis
GO:2001233	0.481	regulation of apoptotic signaling pathway
GO:0060548	0.427	negative regulation of cell death
GO:0051179	0.382	localization
GO:0043069	0.375	negative regulation of programmed cell death
GO:0055080	0.361	monoatomic cation homeostasis
GO:2001242	0.361	regulation of intrinsic apoptotic signaling pathway
GO:0043066	0.345	negative regulation of apoptotic process
GO:0050896	0.316	response to stimulus
GO:0051234	0.311	establishment of localization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0012505	1.000	endomembrane system
GO:0005737	1.000	cytoplasm
GO:0043231	1.000	intracellular membrane-bounded organelle
GO:0005783	0.990	endoplasmic reticulum
GO:0016020	0.844	membrane
GO:0005794	0.831	Golgi apparatus
GO:0031090	0.391	organelle membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]