StarFunc result for job id Q7Z434

User Input

>input (540 residues)
MPFAEDKTYKYICRNFSNFCNVDVVEILPYLPCLTARDQDRLRATCTLSGNRDTLWHLFN
TLQRRPGWVEYFIAALRGCELVDLADEVASVYQSYQPRTSDRPPDPLEPPSLPAERPGPP
TPAAAHSIPYNSCREKEPSYPMPVQETQAPESPGENSEQALQTLSPRAIPRNPDGGPLES
SSDLAALSPLTSSGHQEQDTELGSTHTAGATSSLTPSRGPVSPSVSFQPLARSTPRASRL
PGPTGSVVSTGTSFSSSSPGLASAGAAEGKQGAESDQAEPIICSSGAEAPANSLPSKVPT
TLMPVNTVALKVPANPASVSTVPSKLPTSSKPPGAVPSNALTNPAPSKLPINSTRAGMVP
SKVPTSMVLTKVSASTVPTDGSSRNEETPAAPTPAGATGGSSAWLDSSSENRGLGSELSK
PGVLASQVDSPFSGCFEDLAISASTSLGMGPCHGPEENEYKSEGTFGIHVAENPSIQLLE
GNPGPPADPDGGPRPQADRKFQEREVPCHRPSPGALWLQVAVTGVLVVTLLVVLYRRRLH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z434	0.999	0.999	9.046E-66	540	1.000	1.000	Q7Z434.pdb.gz	MAVS_HUMAN Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS PE=1 SV=2
2	AFDB:A0ZVR1	0.194	0.200	1.634E-29	524	0.565	0.582	A0ZVR1.pdb.gz	A0ZVR1_PIG Mitochondrial antiviral signaling protein OS=Sus scrofa OX=9823 GN=Mavs PE=2 SV=1
3	AFDB:Q8VCF0	0.207	0.221	5.282E-27	503	0.502	0.539	Q8VCF0.pdb.gz	MAVS_MOUSE Mitochondrial antiviral-signaling protein OS=Mus musculus OX=10090 GN=Mavs PE=1 SV=1
4	AFDB:F1S8C6	0.183	0.186	9.080E-27	532	0.541	0.549	F1S8C6.pdb.gz
5	PDB:2vgqA	0.168	0.197	8.905E-14	461	0.169	0.197	2vgqA.pdb.gz	Crystal Structure of Human Ips-1 Caspase Activation Recruitment Domain
6	AFDB:C7C1L6	0.197	0.177	1.600E-8	606	0.222	0.198	C7C1L6.pdb.gz	C7C1L6_SALSA Mitochondrial antiviral signaling OS=Salmo salar OX=8030 GN=mavs PE=2 SV=1
7	AFDB:C7C1L8	0.176	0.164	2.439E-8	585	0.226	0.209	C7C1L8.pdb.gz
8	AFDB:P23497	0.164	0.106	1.002E-1	879	0.148	0.091	P23497.pdb.gz	SP100_HUMAN Nuclear autoantigen Sp-100 OS=Homo sapiens OX=9606 GN=SP100 PE=1 SV=3
9	PDB:4a2wA	0.149	0.120	1.063E-1	678	0.022	0.018	4a2wA.pdb.gz
10	AFDB:Q38BU4	0.065	0.033	2.062E-1	1223	0.167	0.074	Q38BU4.pdb.gz	Q38BU4_TRYB2 Bilobe protein, conserved OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.70.4540 PE=4 SV=1
11	PDB:2gf5A	0.129	0.315	5.399E-1	191	0.037	0.105	2gf5A.pdb.gz
12	PDB:2kn6A	0.080	0.191	7.748E-1	195	0.041	0.113	2kn6A.pdb.gz
13	AFDB:Q13023	0.072	0.025	1.182	2319	0.130	0.030	Q13023.pdb.gz	AKAP6_HUMAN A-kinase anchor protein 6 OS=Homo sapiens OX=9606 GN=AKAP6 PE=1 SV=3
14	AFDB:Q5TI25	0.084	0.058	1.415	921	0.133	0.078	Q5TI25.pdb.gz	NBPFE_HUMAN Neuroblastoma breakpoint family member 14 OS=Homo sapiens OX=9606 GN=NBPF14 PE=2 SV=2
15	PDB:6p6cA	0.070	0.318	1.800	90	0.024	0.144	6p6cA.pdb.gz
16	PDB:7p54A	0.060	0.078	4.180	397	0.024	0.033	7p54A.pdb.gz
17	PDB:6nr7A	0.060	0.038	4.714	1086	0.043	0.021	6nr7A.pdb.gz	Refined model of chicken vinculin suggests the mechanism of activation by helical super-bundle unfurling
18	PDB:2fgeA	0.049	0.029	5.317	979	0.015	0.008	2fgeA.pdb.gz	The closed structure of presequence protease PreP forms a unique 10 000 A(3) chamber for proteolysis
19	PDB:5mqfL	0.063	0.085	5.647	336	0.024	0.039	5mqfL.pdb.gz	Cryo-EM structure of a human spliceosome activated for step 2 of splicing.
20	PDB:7d5sBE	0.063	0.045	5.997	865	0.020	0.013	7d5sBE.pdb.gz	Cryo-EM structure of 90S preribosome with inactive Utp24 (state A2)

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z434	0.0	1081	540	1.000	1.000	MAVS_HUMAN Mitochondrial antiviral-signaling protein OS=Homo sapiens OX=9606 GN=MAVS PE=1 SV=2
2	A0ZVR1	1.15e-158	464	524	0.567	0.584	A0ZVR1_PIG Mitochondrial antiviral signaling protein OS=Sus scrofa OX=9823 GN=Mavs PE=2 SV=1
3	Q8VCF0	3.72e-123	372	503	0.511	0.549	MAVS_MOUSE Mitochondrial antiviral-signaling protein OS=Mus musculus OX=10090 GN=Mavs PE=1 SV=1
4	B8A4W7	1.45e-14	77.4	364	0.069	0.102	B8A4W7_DANRE Mitochondrial antiviral-signaling protein OS=Danio rerio OX=7955 GN=wu:fj20d04 PE=4 SV=1
5	F1REK4	2.02e-14	78.2	585	0.069	0.063	F1REK4_DANRE Mitochondrial antiviral-signaling protein OS=Danio rerio OX=7955 GN=wu:fj20d04 PE=4 SV=1
6	C7C1L6	3.65e-10	65.1	606	0.056	0.050	C7C1L6_SALSA Mitochondrial antiviral signaling OS=Salmo salar OX=8030 GN=mavs PE=2 SV=1
7	D1GEL4	3.98e-10	64.7	606	0.056	0.050	D1GEL4_SALSA Interferon promoter stimulating protein 1 OS=Salmo salar OX=8030 GN=LOC100316613 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16739 CARD_2	9.2e-15	65.8	Caspase recruitment domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000401980

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000263642	0.999	Interferon-induced helicase C domain-containing protein 1
2	9606.ENSP00000329967	0.999	Serine/threonine-protein kinase TBK1
3	9606.ENSP00000369213	0.999	Probable ATP-dependent RNA helicase DDX58
4	9606.ENSP00000433623	0.999	TNF receptor-associated factor 6
5	9606.ENSP00000454207	0.999	TNF receptor-associated factor 3
6	9606.ENSP00000337383	0.998	NACHT, LRR and PYD domains-containing protein 3
7	9606.ENSP00000387334	0.998	NLR family member X1
8	9606.ENSP00000420617	0.998	Mitofusin-1
9	9606.ENSP00000471896	0.998	Interferon regulatory factor 3
10	9606.ENSP00000300589	0.997	Nucleotide-binding oligomerization domain-containing protein 2
11	9606.ENSP00000341268	0.997	Tumor necrosis factor receptor type 1-associated DEATH domain protein
12	9606.ENSP00000235329	0.996	Mitofusin-2
13	9606.ENSP00000247668	0.995	TNF receptor-associated factor 2
14	9606.ENSP00000331288	0.995	Stimulator of interferon genes protein
15	9606.ENSP00000425107	0.995	Ubiquitin-like protein ATG12
16	9606.ENSP00000464030	0.995	Inhibitor of nuclear factor kappa-B kinase subunit epsilon
17	9606.ENSP00000483825	0.992	NF-kappa-B essential modulator
18	9606.ENSP00000259808	0.986	Receptor-interacting serine/threonine-protein kinase 1
19	9606.ENSP00000284320	0.986	Mitochondrial import receptor subunit TOM70
20	9606.ENSP00000251642	0.985	Probable ATP-dependent RNA helicase DHX58

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0140693	1.000	molecular condensate scaffold activity
GO:0035591	1.000	signaling adaptor activity
GO:0019904	1.000	protein domain specific binding
GO:0019901	1.000	protein kinase binding
GO:0050700	0.982	CARD domain binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.998	regulation of cellular process
GO:0050896	0.993	response to stimulus
GO:0009987	0.993	cellular process
GO:0080090	0.991	regulation of primary metabolic process
GO:0051171	0.990	regulation of nitrogen compound metabolic process
GO:0031323	0.987	regulation of cellular metabolic process
GO:0048522	0.986	positive regulation of cellular process
GO:0031349	0.985	positive regulation of defense response
GO:0050778	0.985	positive regulation of immune response
GO:0045088	0.985	regulation of innate immune response
GO:0032103	0.984	positive regulation of response to external stimulus
GO:0065009	0.979	regulation of molecular function
GO:0006355	0.977	regulation of DNA-templated transcription
GO:0002833	0.976	positive regulation of response to biotic stimulus
GO:0051091	0.972	positive regulation of DNA-binding transcription factor activity
GO:0001819	0.966	positive regulation of cytokine production
GO:0051173	0.963	positive regulation of nitrogen compound metabolic process
GO:0051716	0.961	cellular response to stimulus
GO:0031325	0.961	positive regulation of cellular metabolic process
GO:0002376	0.960	immune system process
GO:0032481	0.958	positive regulation of type I interferon production
GO:0048519	0.951	negative regulation of biological process
GO:0045089	0.944	positive regulation of innate immune response
GO:0032675	0.942	regulation of interleukin-6 production
GO:0023051	0.939	regulation of signaling
GO:0051254	0.939	positive regulation of RNA metabolic process
GO:0007165	0.935	signal transduction
GO:0009966	0.930	regulation of signal transduction
GO:0031328	0.925	positive regulation of cellular biosynthetic process
GO:0006950	0.921	response to stress
GO:0045944	0.917	positive regulation of transcription by RNA polymerase II
GO:0032648	0.904	regulation of interferon-beta production
GO:0010033	0.896	response to organic substance
GO:0051707	0.888	response to other organism
GO:0009967	0.887	positive regulation of signal transduction
GO:1902531	0.878	regulation of intracellular signal transduction
GO:0098542	0.876	defense response to other organism
GO:0051246	0.866	regulation of protein metabolic process
GO:1902533	0.862	positive regulation of intracellular signal transduction
GO:0070887	0.858	cellular response to chemical stimulus
GO:0009615	0.825	response to virus
GO:0006955	0.790	immune response
GO:0002253	0.787	activation of immune response
GO:0043122	0.776	regulation of I-kappaB kinase/NF-kappaB signaling
GO:0071310	0.746	cellular response to organic substance
GO:0045087	0.738	innate immune response
GO:0002218	0.730	activation of innate immune response
GO:0051247	0.699	positive regulation of protein metabolic process
GO:0032728	0.654	positive regulation of interferon-beta production
GO:0050688	0.488	regulation of defense response to virus
GO:0050792	0.466	regulation of viral process
GO:0140546	0.437	defense response to symbiont
GO:0051607	0.432	defense response to virus
GO:1903900	0.423	regulation of viral life cycle
GO:0051179	0.419	localization
GO:0051092	0.417	positive regulation of NF-kappaB transcription factor activity
GO:0048525	0.400	negative regulation of viral process
GO:0051641	0.372	cellular localization
GO:0050691	0.372	regulation of defense response to virus by host
GO:0032647	0.367	regulation of interferon-alpha production
GO:0032755	0.367	positive regulation of interleukin-6 production
GO:0045069	0.360	regulation of viral genome replication
GO:0051128	0.359	regulation of cellular component organization
GO:0008104	0.355	protein localization
GO:0002230	0.346	positive regulation of defense response to virus by host
GO:0008152	0.334	metabolic process
GO:0033043	0.334	regulation of organelle organization
GO:0032680	0.321	regulation of tumor necrosis factor production
GO:0071704	0.318	organic substance metabolic process
GO:0033365	0.318	protein localization to organelle
GO:0060759	0.316	regulation of response to cytokine stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031966	1.000	mitochondrial membrane
GO:0098588	0.996	bounding membrane of organelle
GO:0005741	0.959	mitochondrial outer membrane
GO:0042579	0.919	microbody
GO:0005777	0.913	peroxisome
GO:0005829	0.532	cytosol
GO:0031903	0.313	microbody membrane
GO:0032991	0.309	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]