StarFunc result for job id Q7Z442

User Input

>input (2459 residues)
MSAVGLVLLVLALRLRATTVKPEEGSFCSNSQVAFRDACYEFVPLGRTFRDAQSWCEGQG
GHLVFIQDEGTQWFLQKHISQDREWWIGLTWNLARNGTTEGPGTWLDTSNVTYSNWHGGQ
AAAAPDTCGHIGRGPSSEWVTSDCAQTFAFMCEFRVGQSLACEGLNATVHCGLGQVIQVQ
DAVYGRQNPHFCTQDAGRPSDLEQGCSWANVKEEVAGQCQELQSCQVAADETYFGNLCPT
QGSYLWVQYQCREALQLMVSSESFIFDNVTISLTWLLSPYIGNLSCIISTGDSHTFDPYN
PPSVSSNVTHQFTSPGEFTVFAECTTSEWHVTAQRQVTVRDKMETLSVTACSGLSQSGAG
PLCQAVFGDPLWIQVELDGGTGVTYTVLLGDITLAESTTQKGSLPYNLILDRETQKLMGP
GRHRLEIQATGNTTTSTISRNITVHLVELLSGLQASWASDHLELGQDLLITISLAQGTPE
ELTFEVAGLNATFSHEQVSFGEPFGICRLAVPVEGTFLVTMLVRNAFSNLSLEIGNITIT
APSGLQEPSGMNAEGKSKDKGDMEVYIQPGPYVDPFTTVTLGWPDNDKELRFQWSCGSCW
ALWSSCVERQLLRTDQRELVVPASCLPPPDSAVTLRLAVLRGQELENRAEQCLYVSAPWE
LRPRVSCERNCRPVNASKDILLRVTMGEDSPVAMFSWYLDNTPTEQAEPLLDACRLRGFW
PRSLTLLQSNTSTLLLNSSFLQSRGEVIRIRATALTRHAYGEDTYVISTVPPREVPACTI
APEEGTVLTSFAIFCNASTALGPLEFCFCLESGSCLHCGPEPALPSVYLPLGEENNDFVL
TVVISATNRAGDTQQTQAMAKVALGDTCVEDVAFQAAVSEKIPTALQGEGGPEQLLQLAK
AVSSMLNQEHESQGSGQSLSIDVRQKVREHVLGSLSAVTTGLEDVQRVQELAEVLREVTC
RSKELTPSAQWEASLALQHASEALLTVSAKARPEDQRRQAATRDLFQAVGSVLEASLSNR
PEEPAEASSSQIATVLRLLRVMEHVQTTLLLGKLPGGLPAMLATPSISVYTNRIQPWSWQ
GSSLRPDAADSATFMLPAASSLSSLEGGQEPVDIKIMSFPKSPFPARSHFDVSGTVGGLR
VTSPSGQLIPVKNLSENIEILLPRHSQRHSQPTVLNLTSPEALWVNVTSGEATLGIQLHW
RPDIALTLSLGYGYHPNKSSYDAQTHLVPMVAPDELPTWILSPQDLRFGEGVYYLTVVPE
SDLEPAPGRDLTVGITTFLSHCVFWDEVQETWDDSGCQVGPRTSPYQTHCLCNHLTFFGS
TFLVMSNAINIHQTAELFATFEDNPVVVTTVGCLCVVYVLVVIWARRKDAQDQAKVKVTV
LEDNDPFAQYHYLVTVYTGHRRGAATSSKVTVTLYGLDGEREPHHLADPDTPVFERGAVD
AFLLSTLFPLGELRSLRLWHDNSGDRPSWYVSRVLVYDLVMDRKWYFLCNSWLSINVGDC
VLDKVFPVATEQDRKQFSHLFFMKTSAGFQDGHIWYSIFSRCARSSFTRVQRVSCCFSLL
LCTMLTSIMFWGVPKDPAEQKMDLGKIEFTWQEVMIGLESSILMFPINLLIVQIFQNTRP
RVAKEQNTGKWDRGSPNLTPSPQPMEDGLLTPEAVTKDVSRIVSSLFKALKVPSPALGWD
SVNLMDINSLLALVEDVIYPQNTSGQVFWEEAKKREDPVTLTLGSSEMKEKSQCPKPKAA
RSGPWKDSAYRQCLYLQLEHVEQELRLVGPRGFSQPHSHAQALRQLQTLKGGLGVQPGTW
APAHASALQVSKPPQGLPWWCILVGWLLVAATSGVAAFFTMLYGLHYGRASSLRWLISMA
VSFVESMFVTQPLKVLGFAAFFALVLKRVDDEEDTVAPLPGHLLGPDPYALFRARRNSSR
DVYQPPLTAAIEKMKTTHLKEQKAFALIREILAYLGFLWMLLLVAYGQRDPSAYHLNRHL
QHSFTRGFSGVLGFREFFKWANTTLVSNLYGHPPGFITDGNSKLVGSAQIRQVRVQESSC
PLAQQPQAYLNGCRAPYSLDAEDMADYGEGWNATTLSEWQYQSQDQRQGYPIWGKLTVYR
GGGYVVPLGTDRQSTSRILRYLFDNTWLDALTRAVFVESTVYNANVNLFCIVTLTLETSA
LGTFFTHAALQSLRLYPFTDGWHPFVVAAELIYFLFLLYYMVVQGKRMSKETWGYFCSKW
NLLELAIILASWSALAVFVKRAVLAERDLQRCRNHREEGISFSETAAADAALGYIIAFLV
LLSTVKLWHLLRLNPKMNMITAALRRAWGDISGFMIVILTMLLAYSIASNLIFGWKLRSY
KTLFDAAETMVSLQLGIFNYEEVLDYSPVLGSFLIGSCIVFMTFVVLNLFISVILVAFSE
EQKYYQLSEEGEIVDLLLMKILSFLGIKSKREEPGSSREQPGSLSQTRHSRPAQALPKD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2EG98	0.386	0.424	6.548E-88	2201	0.246	0.275	Q2EG98.pdb.gz	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
2	AFDB:Q9NTG1	0.445	0.479	1.807E-84	2253	0.186	0.203	Q9NTG1.pdb.gz	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
3	AFDB:Q9Z0T6	0.349	0.396	3.608E-83	2126	0.179	0.207	Q9Z0T6.pdb.gz	PKDRE_MOUSE Polycystin family receptor for egg jelly OS=Mus musculus OX=10090 GN=Pkdrej PE=2 SV=1
4	AFDB:Q7Z443	0.437	0.599	1.023E-75	1732	0.202	0.286	Q7Z443.pdb.gz	PK1L3_HUMAN Polycystin-1-like protein 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1
5	AFDB:Q8R526	0.284	0.270	2.532E-72	2615	0.176	0.166	Q8R526.pdb.gz	PK1L1_MOUSE Polycystin-1-like protein 1 OS=Mus musculus OX=10090 GN=Pkd1l1 PE=1 SV=2
6	AFDB:F2VYA1	0.193	0.481	1.760E-26	970	0.076	0.193	F2VYA1.pdb.gz	F2VYA1_PIG Polycystin 2, transient receptor potential cation channel OS=Sus scrofa OX=9823 GN=PKD2 PE=2 SV=1
7	AFDB:D4A5F1	0.192	0.479	2.037E-26	966	0.072	0.184	D4A5F1.pdb.gz	D4A5F1_RAT Polycystin 2, transient receptor potential cation channel OS=Rattus norvegicus OX=10116 GN=Pkd2 PE=1 SV=1
8	AFDB:F1R6X2	0.193	0.584	6.077E-25	790	0.059	0.182	F1R6X2.pdb.gz
9	AFDB:A2A259	0.193	0.609	6.780E-25	760	0.056	0.180	A2A259.pdb.gz	PK2L1_MOUSE Polycystin-2-like protein 1 OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1
10	AFDB:Q9NZM6	0.197	0.751	7.565E-25	624	0.054	0.213	Q9NZM6.pdb.gz	PK2L2_HUMAN Polycystin-2-like protein 2 OS=Homo sapiens OX=9606 GN=PKD2L2 PE=2 SV=2
11	PDB:5mkfA	0.179	0.877	1.344E-17	481	0.054	0.277	5mkfA.pdb.gz	Molecular insights into lipid-assisted Ca(2+) regulation of the TRP channel Polycystin-2.
12	PDB:6du8A	0.161	0.892	1.341E-16	421	0.050	0.290	6du8A.pdb.gz
13	PDB:7q5zA	0.066	0.101	2.967E-12	1344	0.054	0.100	7q5zA.pdb.gz
14	PDB:5a42A	0.051	0.070	3.077E-12	1597	0.065	0.100	5a42A.pdb.gz
15	PDB:4ziqA	0.063	0.091	4.947E-12	1450	0.064	0.108	4ziqA.pdb.gz
16	PDB:4lnvA	0.059	0.091	6.871E-12	1276	0.052	0.100	4lnvA.pdb.gz
17	PDB:6h03A	0.059	0.092	1.910E-11	1223	0.051	0.102	6h03A.pdb.gz
18	PDB:7vonA	0.062	0.101	1.185E-10	1399	0.053	0.094	7vonA.pdb.gz
19	PDB:4rtdA	0.060	0.105	2.647E-10	1122	0.057	0.126	4rtdA.pdb.gz
20	PDB:4lnvB	0.048	0.088	1.829E-8	1063	0.046	0.107	4lnvB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2EG98	0.0	808	2201	0.194	0.217	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
2	Q7Z443	2.15e-132	462	1732	0.103	0.147	PK1L3_HUMAN Polycystin-1-like protein 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1
3	P98161	8.07e-75	281	4303	0.173	0.099	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
4	Q9Z0T6	1.63e-68	260	2126	0.098	0.113	PKDRE_MOUSE Polycystin family receptor for egg jelly OS=Mus musculus OX=10090 GN=Pkdrej PE=2 SV=1
5	H2LRU7	5.25e-58	221	901	0.056	0.153	PKD2_ORYLA Polycystin-2 OS=Oryzias latipes OX=8090 GN=pkd2 PE=1 SV=2
6	Q9NTG1	1.38e-57	224	2253	0.048	0.052	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
7	F2VYA1	6.94e-57	218	970	0.062	0.158	F2VYA1_PIG Polycystin 2, transient receptor potential cation channel OS=Sus scrofa OX=9823 GN=PKD2 PE=2 SV=1
8	Q9P0L9	2.37e-56	214	805	0.056	0.170	PK2L1_HUMAN Polycystin-2-like protein 1 OS=Homo sapiens OX=9606 GN=PKD2L1 PE=1 SV=1
9	A2A259	2.48e-54	207	760	0.054	0.176	PK2L1_MOUSE Polycystin-2-like protein 1 OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1
10	Q6IVV8	5.06e-54	209	904	0.056	0.152	PKD2_DANRE Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 SV=1
11	Q13563	1.29e-52	205	968	0.063	0.160	PKD2_HUMAN Polycystin-2 OS=Homo sapiens OX=9606 GN=PKD2 PE=1 SV=3
12	O35245	4.04e-52	203	966	0.061	0.155	PKD2_MOUSE Polycystin-2 OS=Mus musculus OX=10090 GN=Pkd2 PE=1 SV=2
13	D4A5F1	2.87e-50	197	966	0.065	0.167	D4A5F1_RAT Polycystin 2, transient receptor potential cation channel OS=Rattus norvegicus OX=10116 GN=Pkd2 PE=1 SV=1
14	Q9NZM6	9.98e-45	176	624	0.055	0.218	PK2L2_HUMAN Polycystin-2-like protein 2 OS=Homo sapiens OX=9606 GN=PKD2L2 PE=2 SV=2
15	O08852	2.65e-43	177	4293	0.082	0.047	PKD1_MOUSE Polycystin-1 OS=Mus musculus OX=10090 GN=Pkd1 PE=1 SV=2
16	Q9ERV0	2.02e-42	175	4283	0.081	0.046	Q9ERV0_RAT Pkd1 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
17	F1MAD3	3.71e-42	174	4292	0.081	0.046	F1MAD3_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=3
18	A0A8I6AC84	2.91e-40	167	4254	0.080	0.046	A0A8I6AC84_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=1
19	Q9VK95	3.44e-39	162	924	0.044	0.116	Q9VK95_DROME MIP30126p OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=2
20	Q9U1S7	1.26e-38	159	716	0.050	0.172	PKD2_CAEEL Polycystin-2 OS=Caenorhabditis elegans OX=6239 GN=pkd-2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02140 Gal_Lectin	5.7e-12	57.2	Galactose binding lectin domain
2	PF01825 GPS	3.4e-06	38.9	GPCR proteolysis site, GPS, motif
3	PF00520 Ion_trans	2.7e-10	51.5	Ion transport protein
4	PF00059 Lectin_C	3.3e-11	55.2	Lectin C-type domain
5	PF00801 PKD	5.2	18.3	PKD domain
6	PF08016 PKD_channel	4.6e-37	139.1	Polycystin cation channel
7	PF01477 PLAT	1.6e-17	75.6	PLAT/LH2 domain
8	PF20519 Polycystin_dom	3.9e-45	165.3	Polycystin domain
9	PF02010 REJ	8.4e-07	39.8	REJ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61622.XP_010373456.1

Rank	PPI partner	STRING score	Description
1	61622.XP_010358154.1	0.703	Leucine rich repeat containing 27
2	61622.XP_010374780.1	0.644	Zinc finger protein 677
3	61622.XP_010354536.1	0.563	Exocyst complex component 5
4	61622.XP_010361051.1	0.549	Electron transfer flavoprotein beta subunit lysine methyltransferase
5	61622.XP_010374244.1	0.538	Translation machinery-associated protein 16
6	61622.XP_010354480.1	0.508	Belongs to the small GTPase superfamily. Arf family.

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.994	protein binding
GO:0046872	0.698	metal ion binding
GO:0015075	0.690	monoatomic ion transmembrane transporter activity
GO:0005216	0.674	monoatomic ion channel activity
GO:0005261	0.661	monoatomic cation channel activity
GO:0005262	0.472	calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.957	biological regulation
GO:0050789	0.918	regulation of biological process
GO:0009987	0.892	cellular process
GO:0050794	0.806	regulation of cellular process
GO:0006810	0.482	transport
GO:0019222	0.443	regulation of metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0016020	0.989	membrane
GO:0043227	0.945	membrane-bounded organelle
GO:0071944	0.943	cell periphery
GO:0005622	0.926	intracellular anatomical structure
GO:0005886	0.917	plasma membrane
GO:0043229	0.861	intracellular organelle
GO:0043231	0.829	intracellular membrane-bounded organelle
GO:0005737	0.731	cytoplasm
GO:0032991	0.654	protein-containing complex
GO:0005634	0.550	nucleus
GO:0012505	0.361	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.472	Ca(2+)(in) = Ca(2+)(out)

[back to server]