StarFunc result for job id Q7Z443

User Input

>input (1732 residues)
MFFKGGSWLWLYIRTSIILGSELNSPAPHGQNNCYQLNRFQCSFEEAQHYCHVQRGFLAH
IWNKEVQDLIRDYLEEGKKWWIGQNVMPLKKHQDNKYPADVAANGPPKPLSCTYLSRNFI
RISSKGDKCLLKYYFICQTGDFLDGDAHYERNGNNSHLYQRHKKTKRGVAIARDKMPPGP
GHLPTTCHYPLPAHLSKTLCHPISQFPSVLSSITSQVTSAASEPSSQPLPVITQLTMPVS
VTHAGQSLAETTSSPKEEGHPNTFTSYLQVSLQKASGQVIDEIAGNFSRAVHGLQALNKL
QEACEFLQKLTALTPRFSKPAQVNLINSLIYLSEELLRIPFQNNNSLGFKVPPTVCPFHS
LNNVTKAGEGSWLESKRHTEPVEDILEMSLVEFGNIGEAFLEQNQSPESSVTLTSANATL
LLSRQNISTLPLSSYTLGHPAPVRLGFPSALALKELLNKHPGVNVQITGLAFNPFKDLDN
RNIVGSIGSVLLSANRKLLQVHDLMEDIEIMLWRNVSLETHPTSLNMSTHQLTITVNVTS
LEKSLIVSIDPDSPLLMTLYLGFQYQPNCTHFHLNITLPKDKVWQKDEEYTWVLNPEHLQ
HGIGTYYITAVLSERQEGAQQTPSLVSVITAVTQCYYWEIHNQTWSSAGCQVGPQSTILR
TQCLCNHLTFFASDFFVVPRTVNVEDTIKLFLRVTNNPVGVSLLASLLGFYVITVVWARK
KDQADMQKVKVTVLADNDPSAQFHYLIQVYTGYRRSAATTAKVVITLYGSEGRSEPHHLC
DPQKTVFERGGLDVFLLTTWTSLGNLHSLRLWHDNSGVSPSWYVSQVIVCDMAVKRKWHF
LCNCWLAVDLGDCELDRVFIPVSKRELFSFRHLFSSMIVEKFTQDYLWLSIATRHPWNQF
TRVQRLSCCMTLLLCNMVINVMFWKINSTTAKRDEQMRPFAVAWSELLVSIHTAVILFPI
NLVIGRLFPLIEPQETLPLFPPIQASCLSDASVEPLSATMVVEELKETVRFLLRRNTYLL
SKCEQPPWSSWDITKLVKLLSSLVSSHLEGQGCHQQGERHWARVVPENHHHFCCYLHRVL
QRLKSHLGTLGLTQGHQSCDFLDAASQLQKLQELLETHILPTEQEPSREVTSFAILSSEE
GKKPISNGLSKWLTSVCWLLLGFTSLASAFFTALYSLELSKDQATSWMISIILSVLQNIF
ISQPVKVVFFTFLYSLMMSRMPRLNKENEQQTKRILALLAKCSSSVPGSRDKNNPVYVAP
AINSPTKHPERTLKKKKLFKLTGDILVQILFLTLLMTAIYSAKNSNRFYLHQAIWKTFSH
QFSEIKLLQDFYPWANHILLPSLYGDYRGKNAVLEPSHCKCGVQLIFQIPRTKTYEKVDE
GQLAFCDNGHTCGRPKSLFPGLHLRRFSYICSPRPMVLIPTDELHERLTSKNENGFSYIM
RGAFFTSLRLESFTSLQMSKKGCVWSIISQVIYYLLVCYYAFIQGCQLKQQKWRFFTGKR
NILDTSIILISFILLGLDMKSISLHKKNMARYRDDQDRFISFYEAVKVNSAATHLVGFPV
LLATVQLWNLLRHSPRLRVISRTLSRAWDEVVGFLLIILILLTGYAIAFNLLFGCSISDY
RTFFSSAVTVVGLLMGISHQEEVFALDPVLGTFLILTSVILMVLVVINLFVSAILMAFGK
ERKSLKKEAALIDTLLQKLSNLLGISWPQKTSSEQAATTAVGSDTEVLDELP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2EG98	0.492	0.411	0.000	2201	0.565	0.445	Q2EG98.pdb.gz	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
2	AFDB:Q7Z443	1.000	1.000	0.000	1732	1.000	1.000	Q7Z443.pdb.gz	PK1L3_HUMAN Polycystin-1-like protein 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1
3	AFDB:Q9NTG1	0.480	0.385	1.722E-59	2253	0.164	0.126	Q9NTG1.pdb.gz	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
4	AFDB:Q9U1S7	0.221	0.511	1.921E-14	716	0.043	0.105	Q9U1S7.pdb.gz	PKD2_CAEEL Polycystin-2 OS=Caenorhabditis elegans OX=6239 GN=pkd-2 PE=1 SV=3
5	AFDB:Q9NZM6	0.221	0.579	1.171E-13	624	0.047	0.131	Q9NZM6.pdb.gz	PK2L2_HUMAN Polycystin-2-like protein 2 OS=Homo sapiens OX=9606 GN=PKD2L2 PE=2 SV=2
6	AFDB:A2A259	0.213	0.471	1.227E-13	760	0.052	0.118	A2A259.pdb.gz	PK2L1_MOUSE Polycystin-2-like protein 1 OS=Mus musculus OX=10090 GN=Pkd2l1 PE=1 SV=1
7	AFDB:F1R6X2	0.216	0.447	6.507E-13	790	0.050	0.110	F1R6X2.pdb.gz
8	AFDB:Q9P0L9	0.214	0.448	4.154E-12	805	0.055	0.118	Q9P0L9.pdb.gz	PK2L1_HUMAN Polycystin-2-like protein 1 OS=Homo sapiens OX=9606 GN=PKD2L1 PE=1 SV=1
9	AFDB:Q8T8Z2	0.206	0.457	1.748E-11	736	0.055	0.129	Q8T8Z2.pdb.gz	Q8T8Z2_DROME AT14535p OS=Drosophila melanogaster OX=7227 GN=brv2 PE=2 SV=1
10	AFDB:X2JI61	0.198	0.433	3.724E-10	750	0.055	0.127	X2JI61.pdb.gz	X2JI61_DROME Brivido-3, isoform C OS=Drosophila melanogaster OX=7227 GN=brv3 PE=3 SV=1
11	PDB:5mkfA	0.213	0.707	2.825E-8	481	0.043	0.154	5mkfA.pdb.gz	Molecular insights into lipid-assisted Ca(2+) regulation of the TRP channel Polycystin-2.
12	PDB:6ncfB	0.070	0.166	6.603E-7	676	0.028	0.071	6ncfB.pdb.gz	Structural and mechanistic insights into 5-lipoxygenase inhibition by natural products.
13	PDB:6du8A	0.172	0.651	7.948E-7	421	0.042	0.173	6du8A.pdb.gz
14	PDB:4o9yA	0.050	0.038	5.832E-6	2490	0.073	0.051	4o9yA.pdb.gz
15	PDB:7ttjB	0.062	0.176	8.449E-6	590	0.020	0.058	7ttjB.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
16	PDB:7ttjA	0.064	0.157	8.850E-6	643	0.025	0.067	7ttjA.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
17	PDB:7ttlC	0.059	0.162	1.282E-5	617	0.020	0.055	7ttlC.pdb.gz	Helical remodeling augments 5-lipoxygenase activity in the synthesis of proinflammatory mediators.
18	PDB:3v99B	0.063	0.167	2.236E-5	639	0.021	0.056	3v99B.pdb.gz	Conversion of human 5-lipoxygenase to a 15-lipoxygenase by a point mutation to mimic phosphorylation at Serine-663.
19	PDB:2p0mA	0.062	0.157	2.342E-5	662	0.017	0.045	2p0mA.pdb.gz	Conformational flexibility in mammalian 15S-lipoxygenase: Reinterpretation of the crystallographic data.
20	PDB:4nreA	0.063	0.155	3.723E-5	675	0.017	0.044	4nreA.pdb.gz	The structure of human 15-lipoxygenase-2 with a substrate mimic.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q2EG98	0.0	1432	2201	0.426	0.335	PK1L3_MOUSE Polycystin-1-like protein 3 OS=Mus musculus OX=10090 GN=Pkd1l3 PE=1 SV=2
2	Q7Z443	0.0	3586	1732	1.000	1.000	PK1L3_HUMAN Polycystin-1-like protein 3 OS=Homo sapiens OX=9606 GN=PKD1L3 PE=1 SV=1
3	Q9Z0T6	1.13e-49	197	2126	0.069	0.056	PKDRE_MOUSE Polycystin family receptor for egg jelly OS=Mus musculus OX=10090 GN=Pkdrej PE=2 SV=1
4	Q9NTG1	5.49e-46	185	2253	0.066	0.051	PKDRE_HUMAN Polycystin family receptor for egg jelly OS=Homo sapiens OX=9606 GN=PKDREJ PE=2 SV=2
5	E7FKV8	1.29e-37	158	2742	0.063	0.040	PK1L1_ORYLA Polycystin-1-like protein 1 OS=Oryzias latipes OX=8090 GN=pkd1l1 PE=1 SV=2
6	P98161	9.49e-36	152	4303	0.064	0.026	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
7	F1MAD3	3.07e-34	147	4292	0.058	0.024	F1MAD3_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=3
8	Q9ERV0	3.48e-34	147	4283	0.058	0.024	Q9ERV0_RAT Pkd1 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
9	A0A8I6AC84	3.50e-34	147	4254	0.058	0.024	A0A8I6AC84_RAT Polycystin 1, transient receptor potential channel interacting OS=Rattus norvegicus OX=10116 GN=Pkd1 PE=3 SV=1
10	O08852	8.56e-34	145	4293	0.057	0.023	PKD1_MOUSE Polycystin-1 OS=Mus musculus OX=10090 GN=Pkd1 PE=1 SV=2
11	Q8R526	2.81e-28	127	2615	0.054	0.036	PK1L1_MOUSE Polycystin-1-like protein 1 OS=Mus musculus OX=10090 GN=Pkd1l1 PE=1 SV=2
12	Q8TDX9	1.87e-26	121	2849	0.045	0.027	PK1L1_HUMAN Polycystin-1-like protein 1 OS=Homo sapiens OX=9606 GN=PKD1L1 PE=1 SV=1
13	Q09624	8.37e-21	103	3284	0.050	0.026	PKD1_CAEEL Location of vulva defective 1 OS=Caenorhabditis elegans OX=6239 GN=lov-1 PE=1 SV=4
14	C8YR32	4.21e-18	94.0	2068	0.027	0.023	LOXH1_MOUSE Lipoxygenase homology domain-containing protein 1 OS=Mus musculus OX=10090 GN=Loxhd1 PE=2 SV=1
15	Q8IVV2	9.47e-16	86.3	2067	0.025	0.021	LOXH1_HUMAN Lipoxygenase homology domain-containing protein 1 OS=Homo sapiens OX=9606 GN=LOXHD1 PE=2 SV=4
16	Q6IVV8	4.67e-13	77.0	904	0.030	0.058	PKD2_DANRE Polycystin-2 OS=Danio rerio OX=7955 GN=pkd2 PE=1 SV=1
17	H2LRU7	1.18e-12	75.9	901	0.028	0.054	PKD2_ORYLA Polycystin-2 OS=Oryzias latipes OX=8090 GN=pkd2 PE=1 SV=2
18	Q9VK95	1.61e-11	72.0	924	0.032	0.061	Q9VK95_DROME MIP30126p OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=2
19	F2VYA1	5.00e-11	70.5	970	0.029	0.052	F2VYA1_PIG Polycystin 2, transient receptor potential cation channel OS=Sus scrofa OX=9823 GN=PKD2 PE=2 SV=1
20	Q6T3S5	6.20e-11	70.1	924	0.032	0.060	Q6T3S5_DROME AMO OS=Drosophila melanogaster OX=7227 GN=Pkd2 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11969 DcpS_C	4.8e+02	12.6	Scavenger mRNA decapping enzyme C-term binding
2	PF01825 GPS	3.8e-05	35.5	GPCR proteolysis site, GPS, motif
3	PF00520 Ion_trans	2.6e-06	38.4	Ion transport protein
4	PF00059 Lectin_C	0.0058	28.7	Lectin C-type domain
5	PF08016 PKD_channel	1.4e-31	121.2	Polycystin cation channel
6	PF01477 PLAT	1.1e-17	76.0	PLAT/LH2 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000480090

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000325296	0.924	Polycystic kidney disease 2-like 1 protein
2	9606.ENSP00000485105	0.857	Polycystic kidney disease protein 1-like 2
3	9606.ENSP00000155858	0.825	Transient receptor potential cation channel subfamily M member 5
4	9606.ENSP00000329926	0.777	Calcium homeostasis modulator protein 1
5	9606.ENSP00000247881	0.668	Taste receptor type 2 member 4
6	9606.ENSP00000331867	0.666	Taste receptor type 1 member 1
7	9606.ENSP00000375095	0.665	Taste receptor type 2 member 13
8	9606.ENSP00000344411	0.659	Taste receptor type 1 member 3
9	9606.ENSP00000300061	0.646	Amiloride-sensitive sodium channel subunit gamma
10	9606.ENSP00000333568	0.643	Serine/threonine-protein kinase D1
11	9606.ENSP00000448219	0.638	Taste receptor type 2 member 38
12	9606.ENSP00000345751	0.636	Amiloride-sensitive sodium channel subunit beta
13	9606.ENSP00000371932	0.631	Taste receptor type 2 member 1
14	9606.ENSP00000220809	0.630	Tissue-type plasminogen activator
15	9606.ENSP00000364520	0.621	Taste receptor type 1 member 2
16	9606.ENSP00000260402	0.595	1-phosphatidylinositol 4,5-bisphosphate phosphodiesterase beta-2
17	9606.ENSP00000420194	0.590	Extracellular calcium-sensing receptor
18	9606.ENSP00000240619	0.573	Taste receptor type 2 member 10
19	9606.ENSP00000381339	0.516	Guanine nucleotide-binding protein G(t) subunit alpha-3
20	9606.ENSP00000327724	0.514	Taste receptor type 2 member 60

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003674	1.000	molecular_function
GO:0005515	0.993	protein binding
GO:0005215	0.843	transporter activity
GO:0015267	0.830	channel activity
GO:0015075	0.821	monoatomic ion transmembrane transporter activity
GO:0005216	0.774	monoatomic ion channel activity
GO:0008324	0.671	monoatomic cation transmembrane transporter activity
GO:0005261	0.543	monoatomic cation channel activity
GO:0038023	0.372	signaling receptor activity
GO:0004888	0.358	transmembrane signaling receptor activity
GO:0005262	0.327	calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0032501	0.996	multicellular organismal process
GO:0050909	0.994	sensory perception of taste
GO:0009987	0.623	cellular process
GO:0065007	0.498	biological regulation
GO:0050896	0.480	response to stimulus
GO:0006811	0.363	monoatomic ion transport
GO:0050789	0.359	regulation of biological process
GO:0042221	0.330	response to chemical
GO:0050794	0.329	regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0043227	0.998	membrane-bounded organelle
GO:0031982	0.988	vesicle
GO:0070062	0.975	extracellular exosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.327	Ca(2+)(in) = Ca(2+)(out)

[back to server]