StarFunc result for job id Q7Z460

User Input

>input (1538 residues)
MEPRMESCLAQVLQKDVGKRLQVGQELIDYFSDKQKSADLEHDQTMLDKLVDGLATSWVN
SSNYKVVLLGMDILSALVTRLQDRFKAQIGTVLPSLIDRLGDAKDSVREQDQTLLLKIMD
QAANPQYVWDRMLGGFKHKNFRTREGICLCLIATLNASGAQTLTLSKIVPHICNLLGDPN
SQVRDAAINSLVEIYRHVGERVRADLSKKGLPQSRLNVIFTKFDEVQKSGNMIQSANDKN
FDDEDSVDGNRPSSASSTSSKAPPSSRRNVGMGTTRRLGSSTLGSKSSAAKEGAGAVDEE
DFIKAFDDVPVVQIYSSRDLEESINKIREILSDDKHDWEQRVNALKKIRSLLLAGAAEYD
NFFQHLRLLDGAFKLSAKDLRSQVVREACITLGHLSSVLGNKFDHGAEAIMPTIFNLIPN
SAKIMATSGVVAVRLIIRHTHIPRLIPVITSNCTSKSVAVRRRCFEFLDLLLQEWQTHSL
ERHISVLAETIKKGIHDADSEARIEARKCYWGFHSHFSREAEHLYHTLESSYQKALQSHL
KNSDSIVSLPQSDRSSSSSQESLNRPLSAKRSPTGSTTSRASTVSTKSVSTTGSLQRSRS
DIDVNAAASAKSKVSSSSGTTPFSSAAALPPGSYASLGRIRTRRQSSGSATNVASTPDNR
GRSRAKVVSQSQRSRSANPAGAGSRSSSPGKLLGSGYGGLTGGSSRGPPVTPSSEKRSKI
PRSQGCSRETSPNRIGLARSSRIPRPSMSQGCSRDTSRESSRDTSPARGFPPLDRFGLGQ
PGRIPGSVNAMRVLSTSTDLEAAVADALKKPVRRRYEPYGMYSDDDANSDASSVCSERSY
GSRNGGIPHYLRQTEDVAEVLNHCASSNWSERKEGLLGLQNLLKSQRTLSRVELKRLCEI
FTRMFADPHSKRVFSMFLETLVDFIIIHKDDLQDWLFVLLTQLLKKMGADLLGSVQAKVQ
KALDVTRDSFPFDQQFNILMRFIVDQTQTPNLKVKVAILKYIESLARQMDPTDFVNSSET
RLAVSRIITWTTEPKSSDVRKAAQIVLISLFELNTPEFTMLLGALPKTFQDGATKLLHNH
LKNSSNTSVGSPSNTIGRTPSRHTSSRTSPLTSPTNCSHGGLSPSRLWGWSADGLAKHPP
PFSQPNSIPTAPSHKALRRSYSPSMLDYDTENLNSEEIYSSLRGVTEAIEKFSFRSQEDL
NEPIKRDGKKECDIVSRDGGAASPATEGRGGSEVEGGRTALDNKTSLLNTQPPRAFPGPR
ARDYNPYPYSDAINTYDKTALKEAVFDDDMEQLRDVPIDHSDLVADLLKELSNHNERVEE
RKGALLELLKITREDSLGVWEEHFKTILLLLLETLGDKDHSIRALALRVLREILRNQPAR
FKNYAELTIMKTLEAHKDSHKEVVRAAEEAASTLASSIHPEQCIKVLCPIIQTADYPINL
AAIKMQTKVVERIAKESLLQLLVDIIPGLLQGYDNTESSVRKASVFCLVAIYSVIGEDLK
PHLAQLTGSKMKLLNLYIKRAQTTNSNSSSSSDVSTHS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z460	1.000	1.000	0.000	1538	1.000	1.000	Q7Z460.pdb.gz	CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1
2	AFDB:A0A1B0GWM1	0.166	0.710	5.987E-31	345	0.220	0.980	A0A1B0GWM1.pdb.gz	A0A1B0GWM1_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
3	PDB:4a0cA	0.141	0.168	1.661E-10	1155	0.104	0.139	4a0cA.pdb.gz	The Molecular Basis of Crl4(Ddb2/Csa) Ubiquitin Ligase Architecture, Targeting, and Activation
4	PDB:3w3uA	0.115	0.156	3.863E-9	1030	0.093	0.139	3w3uA.pdb.gz
5	PDB:6xu2A	0.134	0.170	1.411E-8	1091	0.102	0.144	6xu2A.pdb.gz	X-ray Structure of the Human Karyopherin RanBP5, an Essential Factor for Influenza Polymerase Nuclear Trafficking.
6	PDB:6bcuA	0.122	0.094	9.325E-8	2204	0.092	0.064	6bcuA.pdb.gz	Mechanisms of mTORC1 activation by RHEB and inhibition by PRAS40.
7	PDB:3w3zA	0.124	0.164	1.042E-7	1013	0.094	0.142	3w3zA.pdb.gz	Structural basis for cell-cycle-dependent nuclear import mediated by the karyopherin Kap121p.
8	PDB:1qgkA	0.110	0.184	1.350E-7	876	0.072	0.127	1qgkA.pdb.gz
9	PDB:2z6gA	0.102	0.240	3.049E-7	550	0.040	0.113	2z6gA.pdb.gz
10	PDB:7mqaSP	0.138	0.098	3.807E-7	2485	0.090	0.056	7mqaSP.pdb.gz	Nucleolar maturation of the human small subunit processome.
11	PDB:1b3uA	0.140	0.288	6.635E-7	588	0.054	0.141	1b3uA.pdb.gz
12	PDB:4jlqA	0.118	0.183	1.391E-6	840	0.080	0.146	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
13	AFDB:Q6PR54	0.075	0.057	5.340E-5	2419	0.110	0.070	Q6PR54.pdb.gz	RIF1_MOUSE Telomere-associated protein RIF1 OS=Mus musculus OX=10090 GN=Rif1 PE=1 SV=2
14	AFDB:Q9VW83	0.078	0.069	1.251E-4	1847	0.112	0.094	Q9VW83.pdb.gz	Q9VW83_DROME Gigas, isoform A OS=Drosophila melanogaster OX=7227 GN=gig PE=1 SV=1
15	AFDB:Q961B0	0.095	0.127	4.091E-4	1067	0.099	0.142	Q961B0.pdb.gz	Q961B0_DROME LD24920p OS=Drosophila melanogaster OX=7227 GN=Apc2 PE=2 SV=1
16	AFDB:Q9VW47	0.072	0.053	8.578E-4	2531	0.094	0.057	Q9VW47.pdb.gz	MED12_DROME Mediator of RNA polymerase II transcription subunit 12 OS=Drosophila melanogaster OX=7227 GN=kto PE=1 SV=2
17	AFDB:Q9VAS9	0.092	0.063	2.605E-3	2417	0.111	0.071	Q9VAS9.pdb.gz	Q9VAS9_DROME APC-like, isoform A OS=Drosophila melanogaster OX=7227 GN=Apc PE=3 SV=1
18	AFDB:Q9P2D8	0.086	0.061	3.634E-3	2635	0.122	0.071	Q9P2D8.pdb.gz	UNC79_HUMAN Protein unc-79 homolog OS=Homo sapiens OX=9606 GN=UNC79 PE=1 SV=4
19	AFDB:P39960	0.065	0.056	1.104E-2	2167	0.099	0.070	P39960.pdb.gz	BEM2_YEAST GTPase-activating protein BEM2/IPL2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=BEM2 PE=1 SV=1
20	AFDB:Q13009	0.054	0.056	1.280E-2	1591	0.097	0.094	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JTD7	0.0	2516	1420	0.875	0.947	A0A0G2JTD7_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
2	A0A0G2JUI5	0.0	2776	1539	0.939	0.938	A0A0G2JUI5_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
3	A0A0U1RQI6	0.0	1702	1304	0.599	0.706	A0A0U1RQI6_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
4	A0A1B0GWM1	0.0	2649	1478	0.910	0.947	A0A1B0GWM1_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
5	A0A1B0GWS3	0.0	2362	1247	0.772	0.953	A0A1B0GWS3_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=2
6	A0A8I5ZL32	0.0	2678	1495	0.917	0.944	A0A8I5ZL32_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=1
7	A0A8I6AEZ5	0.0	3081	1555	0.981	0.970	A0A8I6AEZ5_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=1
8	E3W994	0.0	1707	1273	0.596	0.720	E3W994_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=2
9	E7ERI8	0.0	1989	1513	0.689	0.700	E7ERI8_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
10	E7EW49	0.0	1988	1514	0.690	0.701	E7EW49_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
11	F1LNQ9	0.0	3095	1539	0.981	0.981	F1LNQ9_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
12	F1LNR0	0.0	2952	1529	0.952	0.957	F1LNR0_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
13	F1LNR1	0.0	2648	1470	0.909	0.951	F1LNR1_RAT Cytoplasmic linker associated protein 1 OS=Rattus norvegicus OX=10116 GN=Clasp1 PE=1 SV=4
14	J3KR49	0.0	1694	1293	0.594	0.706	J3KR49_HUMAN Cytoplasmic linker associated protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=1
15	O75122	0.0	1700	1294	0.594	0.706	CLAP2_HUMAN CLIP-associating protein 2 OS=Homo sapiens OX=9606 GN=CLASP2 PE=1 SV=3
16	Q7Z460	0.0	3159	1538	1.000	1.000	CLAP1_HUMAN CLIP-associating protein 1 OS=Homo sapiens OX=9606 GN=CLASP1 PE=1 SV=1
17	Q80TV8	0.0	3087	1535	0.979	0.980	CLAP1_MOUSE CLIP-associating protein 1 OS=Mus musculus OX=10090 GN=Clasp1 PE=1 SV=2
18	Q8BRT1	0.0	1686	1286	0.588	0.703	CLAP2_MOUSE CLIP-associating protein 2 OS=Mus musculus OX=10090 GN=Clasp2 PE=1 SV=1
19	Q99JD4	0.0	1684	1286	0.588	0.704	CLAP2_RAT CLIP-associating protein 2 OS=Rattus norvegicus OX=10116 GN=Clasp2 PE=1 SV=1
20	Q9NBD7	4.70e-170	553	1491	0.245	0.253	CLASP_DROME CLIP-associating protein OS=Drosophila melanogaster OX=7227 GN=chb PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01602 Adaptin_N	0.21	21.8	Adaptin N terminal region
2	PF12348 CLASP_N	2.2e-44	163.3	CLASP N terminal
3	PF12717 Cnd1	0.00013	33.6	non-SMC mitotic condensation complex subunit 1
4	PF12243 CTK3	1.9e+02	13.4	CTD kinase subunit gamma CTK3
5	PF04118 Dopey_N	86	13.7	Dopey, N-terminal
6	PF19011 DUF5740	2.5e+02	13.4	Family of unknown function (DUF5740)
7	PF20416 DUF6700	21	16.0	Domain of unknown function (DUF6700)
8	PF02985 HEAT	5.8e-14	62.0	HEAT repeat
9	PF13646 HEAT_2	1.1e-06	40.3	HEAT repeats
10	PF13513 HEAT_EZ	1.5e-05	36.7	HEAT-like repeat
11	PF14500 MMS19_N	2.4	19.2	Dos2-interacting transcription regulator of RNA-Pol-II
12	PF10274 ParcG	53	15.4	Parkin co-regulated protein
13	PF18365 PI_PP_C	1.4e+02	14.0	Phosphoinositide phosphatase C-terminal domain
14	PF14663 RasGEF_N_2	5.3e+02	12.5	Rapamycin-insensitive companion of mTOR RasGEF_N domain
15	PF10363 RTP1_C1	0.064	24.8	Required for nuclear transport of RNA pol II C-terminus 1
16	PF12783 Sec7_N	3.7e-05	35.2	Guanine nucleotide exchange factor in Golgi transport N-terminal
17	PF11640 TAN	6.3e+02	11.9	Telomere-length maintenance and DNA damage repair
18	PF12612 TFCD_C	0.6	21.4	Tubulin folding cofactor D C terminal
19	PF12755 Vac14_Fab1_bd	0.014	27.4	Vacuolar 14 Fab1-binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000263710

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000223398	0.925	CAP-Gly domain-containing linker protein 2
2	9606.ENSP00000479322	0.920	CAP-Gly domain-containing linker protein 1
3	9606.ENSP00000268919	0.902	Kinesin-like protein KIF2B
4	9606.ENSP00000364721	0.851	Microtubule-associated protein RP/EB family member 1
5	9606.ENSP00000221455	0.850	CLK4-associating serine/arginine rich protein
6	9606.ENSP00000323300	0.833	Sperm-associated antigen 5
7	9606.ENSP00000432768	0.822	Cytoskeleton-associated protein 5
8	9606.ENSP00000307939	0.798	GRIP and coiled-coil domain-containing protein 2
9	9606.ENSP00000405405	0.773	Pleckstrin homology-like domain family B member 2
10	9606.ENSP00000265148	0.769	Centromere-associated protein E
11	9606.ENSP00000354791	0.708	Dynactin subunit 1
12	9606.ENSP00000233121	0.703	Microtubule-associated protein RP/EB family member 3
13	9606.ENSP00000361423	0.692	Tyrosine-protein kinase ABL1
14	9606.ENSP00000427562	0.691	Abelson tyrosine-protein kinase 2
15	9606.ENSP00000380378	0.685	Platelet-activating factor acetylhydrolase IB subunit alpha
16	9606.ENSP00000260731	0.666	Kinesin-like protein KIF11
17	9606.ENSP00000284770	0.652	PDZ and LIM domain protein 3
18	9606.ENSP00000354573	0.645	Microtubule-actin cross-linking factor 1, isoforms 1/2/3/5
19	9606.ENSP00000361298	0.638	Kinesin-like protein KIF2C
20	9606.ENSP00000264313	0.633	SLAIN motif-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0051010	0.996	microtubule plus-end binding
GO:0002162	0.916	dystroglycan binding
GO:0043515	0.784	kinetochore binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0050794	0.991	regulation of cellular process
GO:0007163	0.946	establishment or maintenance of cell polarity
GO:0070507	0.933	regulation of microtubule cytoskeleton organization
GO:0031110	0.919	regulation of microtubule polymerization or depolymerization
GO:0030010	0.916	establishment of cell polarity
GO:0048522	0.907	positive regulation of cellular process
GO:0010639	0.905	negative regulation of organelle organization
GO:1902904	0.900	negative regulation of supramolecular fiber organization
GO:0051494	0.899	negative regulation of cytoskeleton organization
GO:0044089	0.893	positive regulation of cellular component biogenesis
GO:0071840	0.889	cellular component organization or biogenesis
GO:0051130	0.888	positive regulation of cellular component organization
GO:0007026	0.850	negative regulation of microtubule depolymerization
GO:0016043	0.848	cellular component organization
GO:0045995	0.803	regulation of embryonic development
GO:0048870	0.794	cell motility
GO:0007049	0.786	cell cycle
GO:0007010	0.781	cytoskeleton organization
GO:0022603	0.741	regulation of anatomical structure morphogenesis
GO:0000226	0.741	microtubule cytoskeleton organization
GO:0051179	0.736	localization
GO:0051641	0.707	cellular localization
GO:0022402	0.692	cell cycle process
GO:0051234	0.674	establishment of localization
GO:0000278	0.670	mitotic cell cycle
GO:0010717	0.628	regulation of epithelial to mesenchymal transition
GO:1903053	0.627	regulation of extracellular matrix organization
GO:1903047	0.558	mitotic cell cycle process
GO:0051649	0.520	establishment of localization in cell
GO:0022607	0.468	cellular component assembly
GO:0051094	0.443	positive regulation of developmental process
GO:0032879	0.373	regulation of localization
GO:0007051	0.365	spindle organization
GO:1902850	0.333	microtubule cytoskeleton organization involved in mitosis
GO:0051640	0.325	organelle localization
GO:0140014	0.323	mitotic nuclear division
GO:0050896	0.303	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005575	1.000	cellular_component
GO:0005737	0.993	cytoplasm
GO:0000776	0.992	kinetochore
GO:0005829	0.942	cytosol
GO:0015630	0.885	microtubule cytoskeleton
GO:0043227	0.817	membrane-bounded organelle
GO:0043231	0.784	intracellular membrane-bounded organelle
GO:0005634	0.413	nucleus
GO:0005794	0.387	Golgi apparatus
GO:0005881	0.386	cytoplasmic microtubule
GO:0005876	0.386	spindle microtubule
GO:0005938	0.383	cell cortex
GO:0005925	0.375	focal adhesion
GO:0045180	0.372	basal cortex
GO:0031592	0.372	centrosomal corona
GO:0030981	0.371	cortical microtubule cytoskeleton
GO:0005828	0.368	kinetochore microtubule
GO:0016020	0.321	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]