StarFunc result for job id Q7Z478

User Input

>input (1369 residues)
MGGKNKKHKAPAAAVVRAAVSASRAKSAEAGIAGEAQSKKPVSRPATAAAAAAGSREPRV
KQGPKIYSFNSTNDSSGPANLDKSILKVVINNKLEQRIIGVINEHKKQNNDKGMISGRLT
AKKLQDLYMALQAFSFKTKDIEDAMTNTLLYGGDLHSALDWLCLNLSDDALPEGFSQEFE
EQQPKSRPKFQSPQIQATISPPLQPKTKTYEEDPKSKPKKEEKNMEVNMKEWILRYAEQQ
NEEEKNENSKSLEEEEKFDPNERYLHLAAKLLDAKEQAATFKLEKNKQGQKEAQEKIRKF
QREMETLEDHPVFNPAMKISHQQNERKKPPVATEGESALNFNLFEKSAAATEEEKDKKKE
PHDVRNFDYTARSWTGKSPKQFLIDWVRKNLPKSPNPSFEKVPVGRYWKCRVRVIKSEDD
VLVVCPTILTEDGMQAQHLGATLALYRLVKGQSVHQLLPPTYRDVWLEWSDAEKKREELN
KMETNKPRDLFIAKLLNKLKQQQQQQQQHSENKRENSEDPEESWENLVSDEDFSALSLES
ANVEDLEPVRNLFRKLQSTPKYQKLLKERQQLPVFKHRDSIVETLKRHRVVVVAGETGSG
KSTQVPHFLLEDLLLNEWEASKCNIVCTQPRRISAVSLANRVCDELGCENGPGGRNSLCG
YQIRMESRACESTRLLYCTTGVLLRKLQEDGLLSNVSHVIVDEVHERSVQSDFLLIILKE
ILQKRSDLHLILMSATVDSEKFSTYFTHCPILRISGRSYPVEVFHLEDIIEETGFVLEKD
SEYCQKFLEEEEEVTINVTSKAGGIKKYQEYIPVQTGAHADLNPFYQKYSSRTQHAILYM
NPHKINLDLILELLAYLDKSPQFRNIEGAVLIFLPGLAHIQQLYDLLSNDRRFYSERYKV
IALHSILSTQDQAAAFTLPPPGVRKIVLATNIAETGITIPDVVFVIDTGRTKENKYHESS
QMSSLVETFVSKASALQRQGRAGRVRDGFCFRMYTRERFEGFMDYSVPEILRVPLEELCL
HIMKCNLGSPEDFLSKALDPPQLQVISNAMNLLRKIGACELNEPKLTPLGQHLAALPVNV
KIGKMLIFGAIFGCLDPVATLAAVMTEKSPFTTPIGRKDEADLAKSALAMADSDHLTIYN
AYLGWKKARQEGGYRSEITYCRRNFLNRTSLLTLEDVKQELIKLVKAAGFSSSTTSTSWE
GNRASQTLSFQEIALLKAVLVAGLYDNVGKIIYTKSVDVTEKLACIVETAQGKAQVHPSS
VNRDLQTHGWLLYQEKIRYARVYLRETTLITPFPVLLFGGDIEVQHRERLLSIDGWIYFQ
APVKIAVIFKQLRVLIDSVLRKKLENPKMSLENDKILQIITELIKTENN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z478	1.000	1.000	0.000	1369	1.000	1.000	Q7Z478.pdb.gz	DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2
2	AFDB:Q6P158	0.567	0.560	3.237E-73	1386	0.299	0.295	Q6P158.pdb.gz	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
3	AFDB:F4ILR7	0.507	0.683	3.794E-70	995	0.231	0.318	F4ILR7.pdb.gz	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
4	AFDB:Q382X0	0.539	0.568	1.143E-67	1299	0.249	0.263	Q382X0.pdb.gz	Q382X0_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3930 PE=4 SV=1
5	AFDB:O94536	0.561	0.578	4.220E-62	1327	0.229	0.237	O94536.pdb.gz	UCP12_SCHPO Putative ATP-dependent RNA helicase ucp12 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ucp12 PE=3 SV=1
6	AFDB:Q99PU8	0.517	0.579	4.692E-60	1217	0.226	0.254	Q99PU8.pdb.gz	DHX30_MOUSE ATP-dependent RNA helicase DHX30 OS=Mus musculus OX=10090 GN=Dhx30 PE=1 SV=1
7	PDB:5vheA	0.525	0.813	1.217E-59	871	0.247	0.388	5vheA.pdb.gz	Structural basis of G-quadruplex unfolding by the DEAH/RHA helicase DHX36.
8	AFDB:Q581T1	0.511	0.330	1.840E-58	2167	0.209	0.132	Q581T1.pdb.gz	REH2_TRYB2 RNA editing associated helicase 2 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=REH2 PE=1 SV=1
9	AFDB:Q06698	0.582	0.556	2.308E-58	1435	0.232	0.221	Q06698.pdb.gz	YL419_YEAST Putative ATP-dependent RNA helicase YLR419W OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YLR419W PE=1 SV=1
10	AFDB:Q22307	0.513	0.539	3.630E-58	1301	0.217	0.228	Q22307.pdb.gz	DHX9_CAEEL ATP-dependent RNA helicase A OS=Caenorhabditis elegans OX=6239 GN=rha-1 PE=2 SV=3
11	AFDB:P24785	0.524	0.554	4.553E-58	1293	0.230	0.244	P24785.pdb.gz	MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2
12	PDB:5aorA	0.523	0.701	1.190E-56	1009	0.220	0.298	5aorA.pdb.gz	Structure of the RNA Helicase Mle Reveals the Molecular Mechanisms for Uridine Specificity and RNA-ATP Coupling.
13	PDB:5n9dB	0.540	0.838	7.624E-56	866	0.207	0.327	5n9dB.pdb.gz	Molecular Mechanistic Insights into Drosophila DHX36-Mediated G-Quadruplex Unfolding: A Structure-Based Model.
14	PDB:6id1V	0.422	0.845	9.500E-45	663	0.170	0.351	6id1V.pdb.gz	Structures of the human spliceosomes before and after release of the ligated exon.
15	PDB:3kx2B	0.422	0.740	6.132E-43	755	0.166	0.301	3kx2B.pdb.gz	Structural basis for the function of DEAH helicases
16	PDB:5xjcY	0.432	0.801	7.025E-43	713	0.156	0.299	5xjcY.pdb.gz	An Atomic Structure of the Human Spliceosome
17	PDB:6ff7q	0.407	0.859	7.750E-42	625	0.150	0.330	6ff7q.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
18	PDB:5ylzW	0.406	0.766	1.752E-41	703	0.156	0.304	5ylzW.pdb.gz	Structure of the Post-catalytic Spliceosome from Saccharomyces cerevisiae
19	PDB:7dcpx	0.418	0.824	3.989E-40	670	0.138	0.282	7dcpx.pdb.gz	Mechanism of spliceosome remodeling by the ATPase/helicase Prp2 and its coactivator Spp2.
20	PDB:5wsge	0.405	0.765	4.818E-39	679	0.149	0.300	5wsge.pdb.gz	Structure of a yeast step II catalytically activated spliceosome

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	D4A2Z8	0.0	594	1000	0.251	0.344	DHX36_RAT ATP-dependent DNA/RNA helicase DHX36 OS=Rattus norvegicus OX=10116 GN=Dhx36 PE=1 SV=1
2	F4ILR7	0.0	572	995	0.240	0.331	DEXH1_ARATH DExH-box ATP-dependent RNA helicase DExH1 OS=Arabidopsis thaliana OX=3702 GN=At2g35920 PE=2 SV=1
3	Q05B79	0.0	598	1010	0.251	0.340	DHX36_BOVIN ATP-dependent DNA/RNA helicase DHX36 OS=Bos taurus OX=9913 GN=DHX36 PE=1 SV=1
4	Q6P158	0.0	593	1386	0.254	0.251	DHX57_HUMAN Putative ATP-dependent RNA helicase DHX57 OS=Homo sapiens OX=9606 GN=DHX57 PE=1 SV=2
5	Q6PGC1	0.0	2505	1365	0.909	0.911	DHX29_MOUSE ATP-dependent RNA helicase DHX29 OS=Mus musculus OX=10090 GN=Dhx29 PE=1 SV=1
6	Q7Z478	0.0	2840	1369	1.000	1.000	DHX29_HUMAN ATP-dependent RNA helicase DHX29 OS=Homo sapiens OX=9606 GN=DHX29 PE=1 SV=2
7	Q8VHK9	0.0	598	1001	0.253	0.346	DHX36_MOUSE ATP-dependent DNA/RNA helicase DHX36 OS=Mus musculus OX=10090 GN=Dhx36 PE=1 SV=2
8	Q9H2U1	0.0	595	1008	0.250	0.339	DHX36_HUMAN ATP-dependent DNA/RNA helicase DHX36 OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=2
9	E7EWK3	2.02e-168	525	797	0.219	0.376	E7EWK3_HUMAN RNA helicase (Fragment) OS=Homo sapiens OX=9606 GN=DHX36 PE=1 SV=1
10	F4HYJ6	7.25e-157	507	1206	0.228	0.259	F4HYJ6_ARATH RNA helicase OS=Arabidopsis thaliana OX=3702 GN=At1g48650 PE=1 SV=1
11	Q8SWT2	9.06e-148	475	942	0.207	0.300	Q8SWT2_DROME GH12763p OS=Drosophila melanogaster OX=7227 GN=Rhau PE=1 SV=1
12	Q382X0	1.32e-143	473	1299	0.224	0.236	Q382X0_TRYB2 RNA helicase, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb11.01.3930 PE=4 SV=1
13	P24785	1.00e-135	451	1293	0.215	0.227	MLE_DROME Dosage compensation regulator OS=Drosophila melanogaster OX=7227 GN=mle PE=1 SV=2
14	Q08211	2.12e-135	450	1270	0.218	0.235	DHX9_HUMAN ATP-dependent RNA helicase A OS=Homo sapiens OX=9606 GN=DHX9 PE=1 SV=4
15	Q28141	1.56e-134	448	1287	0.218	0.232	DHX9_BOVIN ATP-dependent RNA helicase A OS=Bos taurus OX=9913 GN=DHX9 PE=1 SV=1
16	H7BXY3	6.52e-128	427	1166	0.202	0.238	H7BXY3_HUMAN RNA helicase OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1
17	Q7L2E3	8.06e-128	427	1194	0.202	0.232	DHX30_HUMAN ATP-dependent RNA helicase DHX30 OS=Homo sapiens OX=9606 GN=DHX30 PE=1 SV=1
18	Q5BJS0	3.72e-127	426	1194	0.198	0.227	DHX30_RAT ATP-dependent RNA helicase DHX30 OS=Rattus norvegicus OX=10116 GN=Dhx30 PE=1 SV=1
19	Q99PU8	6.40e-127	426	1217	0.198	0.223	DHX30_MOUSE ATP-dependent RNA helicase DHX30 OS=Mus musculus OX=10090 GN=Dhx30 PE=1 SV=1
20	O70133	4.16e-124	421	1380	0.209	0.207	DHX9_MOUSE ATP-dependent RNA helicase A OS=Mus musculus OX=10090 GN=Dhx9 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13245 AAA_19	1.3e+02	14.2	AAA domain
2	PF13401 AAA_22	0.072	24.8	AAA domain
3	PF06745 ATPase	1.7e+02	12.9	KaiC
4	PF02239 Cytochrom_D1	2e+02	11.9	Cytochrome D1 heme domain
5	PF00270 DEAD	1.6e-07	42.8	DEAD/DEAH box helicase
6	PF04408 HA2	2.2e-12	58.5	Helicase associated domain (HA2)
7	PF00271 Helicase_C	3.7e-11	54.7	Helicase conserved C-terminal domain
8	PF07717 OB_NTP_bind	8.6e-11	53.4	Oligonucleotide/oligosaccharide-binding (OB)-fold
9	PF16837 SF3A3	3.4e+02	12.8	Pre-mRNA-splicing factor SF3A3, of SF3a complex, Prp9
10	PF16619 SUIM_assoc	65	14.9	Unstructured region C-term to UIM in Ataxin3
11	PF00437 T2SSE	2.4e+02	12.1	Type II/IV secretion system protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000251636

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000419449	0.945	Eukaryotic translation initiation factor 1
2	9606.ENSP00000296674	0.880	40S ribosomal protein S23
3	9606.ENSP00000261868	0.858	Eukaryotic translation initiation factor 3 subunit J
4	9606.ENSP00000289371	0.849	Eukaryotic translation initiation factor 5B
5	9606.ENSP00000435096	0.843	Ribosomal protein S25
6	9606.ENSP00000302896	0.831	Ribosomal protein S9
7	9606.ENSP00000341885	0.827	Ribosomal protein S2
8	9606.ENSP00000368927	0.823	Eukaryotic translation initiation factor 1A, X-chromosomal
9	9606.ENSP00000388806	0.820	Eukaryotic translation initiation factor 4B
10	9606.ENSP00000385958	0.818	Ribosomal protein S14
11	9606.ENSP00000369757	0.817	40S ribosomal protein S6
12	9606.ENSP00000278572	0.814	40S ribosomal protein S3
13	9606.ENSP00000472469	0.814	Ribosomal protein S28
14	9606.ENSP00000346050	0.813	40S ribosomal protein S3a
15	9606.ENSP00000472985	0.807	Ribosomal protein S5
16	9606.ENSP00000293831	0.804	Eukaryotic initiation factor 4A-I
17	9606.ENSP00000354125	0.797	Eukaryotic translation initiation factor 3 subunit B
18	9606.ENSP00000326381	0.792	Eukaryotic initiation factor 4A-II
19	9606.ENSP00000232905	0.785	Eukaryotic translation initiation factor 1b
20	9606.ENSP00000357555	0.780	40S ribosomal protein S27

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0016787	1.000	hydrolase activity
GO:0005515	1.000	protein binding
GO:0003723	1.000	RNA binding
GO:0043021	0.999	ribonucleoprotein complex binding
GO:0050839	0.968	cell adhesion molecule binding
GO:0016462	0.961	pyrophosphatase activity
GO:0045296	0.954	cadherin binding
GO:0043024	0.950	ribosomal small subunit binding
GO:0008494	0.949	translation activator activity
GO:0017111	0.883	ribonucleoside triphosphate phosphatase activity
GO:0140657	0.697	ATP-dependent activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.996	cellular process
GO:0044238	0.994	primary metabolic process
GO:0010467	0.990	gene expression
GO:0034641	0.988	cellular nitrogen compound metabolic process
GO:0044260	0.985	cellular macromolecule metabolic process
GO:0009059	0.977	macromolecule biosynthetic process
GO:0044271	0.977	cellular nitrogen compound biosynthetic process
GO:0002181	0.974	cytoplasmic translation
GO:0006413	0.952	translational initiation
GO:0042254	0.925	ribosome biogenesis
GO:0006996	0.895	organelle organization
GO:0002183	0.888	cytoplasmic translational initiation
GO:0070925	0.830	organelle assembly
GO:0022618	0.830	ribonucleoprotein complex assembly
GO:0042255	0.793	ribosome assembly
GO:0050789	0.599	regulation of biological process
GO:0050794	0.563	regulation of cellular process
GO:0019222	0.372	regulation of metabolic process
GO:0060255	0.359	regulation of macromolecule metabolic process
GO:0010468	0.336	regulation of gene expression
GO:0051171	0.319	regulation of nitrogen compound metabolic process
GO:0080090	0.316	regulation of primary metabolic process
GO:0031323	0.306	regulation of cellular metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043229	1.000	intracellular organelle
GO:0032991	0.989	protein-containing complex
GO:0005829	0.987	cytosol
GO:0043232	0.979	intracellular non-membrane-bounded organelle
GO:0043231	0.968	intracellular membrane-bounded organelle
GO:1990904	0.943	ribonucleoprotein complex
GO:0070013	0.899	intracellular organelle lumen
GO:0005840	0.811	ribosome
GO:0022626	0.797	cytosolic ribosome
GO:0044391	0.732	ribosomal subunit
GO:0022627	0.672	cytosolic small ribosomal subunit
GO:0005634	0.616	nucleus
GO:0016020	0.472	membrane
GO:0005654	0.364	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:3.-.-.-	1.000	Hydrolases.
EC:3.6.1.-	0.962	In phosphorus-containing anhydrides.
RHEA:23680	0.883	a ribonucleoside 5'-triphosphate + H2O = a ribonucleoside 5'-diphosphate + H(+) + phosphate
EC:3.6.1.15	0.883	nucleoside-triphosphate phosphatase.

[back to server]