StarFunc result for job id Q7Z494

User Input

>input (1330 residues)
MGTASSLVSPAGGEVIEDTYGAGGGEACEIPVEVKPKARLLRNSFRRGAGAAAGAGPGSL
PRGVGAGGLLGASFKSTGSSVPELEYAAAEYERLRKEYEIFRVSKNQELLSMGRREAKLD
TENKRLRAELQALQKTYQKILREKESALEAKYQAMERAATFEHDRDKVKRQFKIFRETKE
NEIQDLLRAKRELESKLQRLQAQGIQVFDPGESDSDDNCTDVTAAGTQCEYWTGGALGSE
PSIGSMIQLQQSFRGPEFAHSSIDVEGPFANVNRDDWDIAVASLLQVTPLFSHSLWSNTV
RCYLIYTDETQPEMDLFLKDYSPKLKRMCETMGYFFHAVYFPIDVENQYLTVRKWEIEKS
SLVILFIHLTLPSLLLEDCEEAFLKNPEGKPRLIFHRLEDGKVSSDSVQQLIDQVSNLNK
TSKAKIIDHSGDPAEGVYKTYICVEKIIKQDILGFENTDLETKDLGSEDSIPEEDDFGDV
LWDIHDEQEQMETFQQASNSAHELGFEKYYQRLNDLVAAPAPIPPLLVSGGPGSGKSLLL
SKWIQLQQKNSPNTLILSHFVGRPMSTSSESSLIIKRLTLKLMQHSWSVSALTLDPAKLL
EEFPRWLEKLSARHQGSIIIVIDSIDQVQQVEKHMKWLIDPLPVNVRVIVSVNVETCPPA
WRLWPTLHLDPLSPKDAKSIIIAECHSVDIKLSKEQEKKLERHCRSATTCNALYVTLFGK
MIARAGRAGNLDKILHQCFQCQDTLSLYRLVLHSIRESMANDVDKELMKQILCLVNVSHN
GVSESELMELYPEMSWTFLTSLIHSLYKMCLLTYGCGLLRFQHLQAWETVRLEYLEGPTV
TSSYRQKLINYFTLQLSQDRVTWRSADELPWLFQQQGSKQKLHDCLLNLFVSQNLYKRGH
FAELLSYWQFVGKDKSAMATEYFDSLKQYEKNCEGEDNMSCLADLYETLGRFLKDLGLLS
QAIVPLQRSLEIRETALDPDHPRVAQSLHQLASVYVQWKKFGNAEQLYKQALEISENAYG
ADHPYTARELEALATLYQKQNKYEQAEHFRKKSFKIHQKAIKKKGNLYGFALLRRRALQL
EELTLGKDTPDNARTLNELGVLYYLQNNLETADQFLKRSLEMRERVLGPDHPDCAQSLNN
LAALCNEKKQYDKAEELYERALDIRRRALAPDHPSLAYTVKHLAILYKKMGKLDKAVPLY
ELAVEIRQKSFGPKHPSVATALVNLAVLYSQMKKHVEALPLYERALKIYEDSLGRMHPRV
GETLKNLAVLSYEGGDFEKAAELYKRAMEIKEAETSLLGGKAPSRHSSSGDTFSLKTAHS
PNVFLQQGQR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7TNH6	0.754	0.757	0.000	1325	0.885	0.888	Q7TNH6.pdb.gz	NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus OX=10090 GN=Nphp3 PE=1 SV=2
2	AFDB:Q7Z494	1.000	1.000	0.000	1330	1.000	1.000	Q7Z494.pdb.gz	NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens OX=9606 GN=NPHP3 PE=1 SV=1
3	AFDB:Q5XEY4	0.170	0.381	1.240E-13	564	0.071	0.167	Q5XEY4.pdb.gz	Q5XEY4_ARATH At5g53080 OS=Arabidopsis thaliana OX=3702 GN=WTG1 PE=1 SV=1
4	AFDB:O81629	0.141	0.295	2.095E-13	609	0.074	0.163	O81629.pdb.gz	KLCR1_ARATH Protein KINESIN LIGHT CHAIN-RELATED 1 OS=Arabidopsis thaliana OX=3702 GN=KLCR1 PE=1 SV=1
5	AFDB:A8MZ87	0.123	0.279	1.574E-12	521	0.083	0.213	A8MZ87.pdb.gz	A8MZ87_HUMAN Kinesin light chain OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1
6	AFDB:Q9NSK0	0.135	0.261	1.638E-12	619	0.098	0.210	Q9NSK0.pdb.gz	KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3
7	AFDB:P46822	0.134	0.287	2.452E-12	540	0.101	0.248	P46822.pdb.gz	KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans OX=6239 GN=klc-2 PE=1 SV=2
8	AFDB:B2GV74	0.118	0.227	3.822E-12	622	0.097	0.207	B2GV74.pdb.gz	B2GV74_RAT Kinesin light chain OS=Rattus norvegicus OX=10116 GN=Klc2 PE=1 SV=1
9	AFDB:Q91W40	0.156	0.388	1.562E-10	508	0.082	0.215	Q91W40.pdb.gz	KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus OX=10090 GN=Klc3 PE=1 SV=1
10	AFDB:A0A024QZ47	0.152	0.312	2.978E-10	585	0.077	0.174	A0A024QZ47.pdb.gz
11	PDB:7qe7J	0.116	0.284	3.214E-8	510	0.066	0.173	7qe7J.pdb.gz	High-resolution structure of the Anaphase-promoting complex (APC/C) bound to co-activator Cdh1
12	PDB:5dseA	0.120	0.266	4.094E-8	537	0.070	0.173	5dseA.pdb.gz
13	PDB:3sfzA	0.245	0.283	8.460E-8	1133	0.048	0.056	3sfzA.pdb.gz	Crystal structure of full-length Apaf-1: how the death signal is relayed in the mitochondrial pathway of apoptosis.
14	PDB:8a3tD	0.127	0.287	2.139E-7	560	0.053	0.127	8a3tD.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
15	PDB:7qdrB	0.123	0.134	3.075E-7	1212	0.075	0.083	7qdrB.pdb.gz
16	PDB:7dkhI	0.105	0.145	4.989E-7	914	0.089	0.129	7dkhI.pdb.gz
17	PDB:4horA	0.083	0.208	5.631E-7	482	0.057	0.158	4horA.pdb.gz	Structural basis for viral 5'-PPP-RNA recognition by human IFIT proteins.
18	PDB:6tedQ	0.099	0.133	7.468E-7	890	0.085	0.127	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
19	PDB:8a3tJ	0.110	0.264	8.095E-7	509	0.065	0.171	8a3tJ.pdb.gz	Cryo-EM structure of the S. cerevisiae APC/C-Cdh1 complex
20	PDB:5w5iC	0.113	0.299	1.212E-6	436	0.055	0.167	5w5iC.pdb.gz	Structural insights into IFIT1 dimerization and conformational changes associated with mRNA binding

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P0CI65	0.0	1851	1303	0.693	0.708	NPHP3_DANRE Nephrocystin-3 OS=Danio rerio OX=7955 GN=nphp3 PE=3 SV=1
2	Q6AZT7	0.0	2055	1300	0.766	0.784	NPHP3_XENLA Nephrocystin-3 OS=Xenopus laevis OX=8355 GN=nphp3 PE=2 SV=1
3	Q7TNH6	0.0	2397	1325	0.886	0.889	NPHP3_MOUSE Nephrocystin-3 OS=Mus musculus OX=10090 GN=Nphp3 PE=1 SV=2
4	Q7Z494	0.0	2756	1330	1.000	1.000	NPHP3_HUMAN Nephrocystin-3 OS=Homo sapiens OX=9606 GN=NPHP3 PE=1 SV=1
5	P46824	1.15e-34	142	508	0.086	0.224	KLC_DROME Kinesin light chain OS=Drosophila melanogaster OX=7227 GN=Klc PE=1 SV=1
6	P46822	1.29e-34	142	540	0.062	0.152	KLC_CAEEL Kinesin light chain OS=Caenorhabditis elegans OX=6239 GN=klc-2 PE=1 SV=2
7	Q9NSK0	2.28e-34	143	619	0.063	0.136	KLC4_HUMAN Kinesin light chain 4 OS=Homo sapiens OX=9606 GN=KLC4 PE=1 SV=3
8	Q07866	2.50e-34	142	573	0.063	0.147	KLC1_HUMAN Kinesin light chain 1 OS=Homo sapiens OX=9606 GN=KLC1 PE=1 SV=2
9	A4IG65	4.08e-34	142	618	0.064	0.138	A4IG65_DANRE Kinesin light chain OS=Danio rerio OX=7955 GN=MGC162288 PE=1 SV=1
10	P37285	4.87e-34	141	560	0.063	0.150	KLC1_RAT Kinesin light chain 1 OS=Rattus norvegicus OX=10116 GN=Klc1 PE=1 SV=2
11	Q8CD76	1.21e-33	140	616	0.063	0.136	Q8CD76_MOUSE Kinesin light chain OS=Mus musculus OX=10090 GN=Klc1 PE=1 SV=1
12	A8MZ87	4.39e-33	137	521	0.081	0.207	A8MZ87_HUMAN Kinesin light chain OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1
13	Q9H0B6	2.00e-32	137	622	0.080	0.170	KLC2_HUMAN Kinesin light chain 2 OS=Homo sapiens OX=9606 GN=KLC2 PE=1 SV=1
14	O88447	2.47e-32	135	541	0.086	0.213	KLC1_MOUSE Kinesin light chain 1 OS=Mus musculus OX=10090 GN=Klc1 PE=1 SV=3
15	Q91YS4	3.58e-32	136	619	0.080	0.171	Q91YS4_MOUSE Kinesin light chain OS=Mus musculus OX=10090 GN=Klc2 PE=1 SV=1
16	B2GV74	3.71e-32	136	622	0.080	0.170	B2GV74_RAT Kinesin light chain OS=Rattus norvegicus OX=10116 GN=Klc2 PE=1 SV=1
17	O88448	6.54e-32	135	599	0.067	0.149	KLC2_MOUSE Kinesin light chain 2 OS=Mus musculus OX=10090 GN=Klc2 PE=1 SV=1
18	Q91W40	1.38e-31	133	508	0.067	0.175	KLC3_MOUSE Kinesin light chain 3 OS=Mus musculus OX=10090 GN=Klc3 PE=1 SV=1
19	Q68G30	5.15e-31	131	505	0.060	0.158	KLC3_RAT Kinesin light chain 3 OS=Rattus norvegicus OX=10116 GN=Klc3 PE=1 SV=1
20	Q6P597	3.53e-30	129	504	0.059	0.157	KLC3_HUMAN Kinesin light chain 3 OS=Homo sapiens OX=9606 GN=KLC3 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00244 14-3-3	1.9e+02	13.0	14-3-3 protein
2	PF13191 AAA_16	4.7	19.0	AAA ATPase domain
3	PF13245 AAA_19	1.1	20.9	AAA domain
4	PF13401 AAA_22	61	15.3	AAA domain
5	PF12895 ANAPC3	1.9	20.1	Anaphase-promoting complex, cyclosome, subunit 3
6	PF09986 DUF2225	16	16.7	Uncharacterized protein conserved in bacteria (DUF2225)
7	PF04781 DUF627	7.2e+02	11.6	Protein of unknown function (DUF627)
8	PF16559 GIT_CC	1.6e+02	13.5	GIT coiled-coil Rho guanine nucleotide exchange factor
9	PF07693 KAP_NTPase	2.7	18.8	KAP family P-loop domain
10	PF04212 MIT	10	17.6	MIT (microtubule interacting and transport) domain
11	PF05729 NACHT	0.087	24.2	NACHT domain
12	PF18363 PI_PP_I	3.5e+02	12.8	Phosphoinositide phosphatase insertion domain
13	PF04910 Tcf25	1.7	19.2	Transcriptional repressor TCF25
14	PF00515 TPR_1	2e-32	120.8	Tetratricopeptide repeat
15	PF13374 TPR_10	5.7e-62	215.3	Tetratricopeptide repeat
16	PF13414 TPR_11	0.048	24.7	TPR repeat
17	PF13424 TPR_12	4.4e-88	301.0	Tetratricopeptide repeat
18	PF13428 TPR_14	0.00089	30.9	Tetratricopeptide repeat
19	PF13432 TPR_16	1.3e-12	59.4	Tetratricopeptide repeat
20	PF13431 TPR_17	1.3e-05	36.3	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000338766

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000344942	0.973	Protein unc-119 homolog B
2	9606.ENSP00000337040	0.940	Protein unc-119 homolog A
3	9606.ENSP00000262457	0.933	Inversin
4	9606.ENSP00000371234	0.921	Cystin-1
5	9606.ENSP00000367398	0.919	Nephrocystin-4
6	9606.ENSP00000268766	0.914	Serine/threonine-protein kinase Nek8
7	9606.ENSP00000238616	0.898	Serine/threonine-protein kinase Nek9
8	9606.ENSP00000260746	0.883	ADP-ribosylation factor-like protein 3
9	9606.ENSP00000313169	0.883	Nephrocystin-1
10	9606.ENSP00000389998	0.873	Meckelin
11	9606.ENSP00000278935	0.850	Centrosomal protein of 164 kDa
12	9606.ENSP00000448012	0.846	Centrosomal protein of 290 kDa
13	9606.ENSP00000369257	0.835	Protein fantom
14	9606.ENSP00000311505	0.806	IQ calmodulin-binding motif-containing protein 1
15	9606.ENSP00000440638	0.780	Transmembrane protein 216
16	9606.ENSP00000297837	0.770	Ankyrin repeat and SAM domain-containing protein 6
17	9606.ENSP00000403465	0.768	Coiled-coil and C2 domain-containing protein 2A
18	9606.ENSP00000356774	0.761	Jouberin
19	9606.ENSP00000376827	0.756	Meckel syndrome type 1 protein
20	9606.ENSP00000243578	0.737	B9 domain-containing protein 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.978	cellular process
GO:0050794	0.958	regulation of cellular process
GO:0032501	0.939	multicellular organismal process
GO:0048856	0.906	anatomical structure development
GO:0007275	0.895	multicellular organism development
GO:0048523	0.879	negative regulation of cellular process
GO:0071840	0.839	cellular component organization or biogenesis
GO:0048598	0.839	embryonic morphogenesis
GO:0007017	0.837	microtubule-based process
GO:0030111	0.810	regulation of Wnt signaling pathway
GO:0022603	0.806	regulation of anatomical structure morphogenesis
GO:0016043	0.802	cellular component organization
GO:0099111	0.788	microtubule-based transport
GO:0072001	0.740	renal system development
GO:2000027	0.728	regulation of animal organ morphogenesis
GO:0007368	0.728	determination of left/right symmetry
GO:0030030	0.726	cell projection organization
GO:0048513	0.722	animal organ development
GO:0090175	0.717	regulation of establishment of planar polarity
GO:2000050	0.711	regulation of non-canonical Wnt signaling pathway
GO:0006996	0.708	organelle organization
GO:0007018	0.686	microtubule-based movement
GO:0006858	0.681	extracellular transport
GO:0001822	0.680	kidney development
GO:0060562	0.680	epithelial tube morphogenesis
GO:0003351	0.651	epithelial cilium movement involved in extracellular fluid movement
GO:0035050	0.647	embryonic heart tube development
GO:0044782	0.603	cilium organization
GO:0060993	0.587	kidney morphogenesis
GO:0044085	0.586	cellular component biogenesis
GO:0003143	0.574	embryonic heart tube morphogenesis
GO:0060271	0.569	cilium assembly
GO:0001889	0.501	liver development
GO:0060026	0.477	convergent extension
GO:0031016	0.463	pancreas development
GO:0071910	0.441	determination of liver left/right asymmetry
GO:0061371	0.395	determination of heart left/right asymmetry
GO:0055123	0.365	digestive system development

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005929	1.000	cilium
GO:0005829	0.978	cytosol
GO:0043229	0.791	intracellular organelle
GO:0043232	0.463	intracellular non-membrane-bounded organelle
GO:0043231	0.411	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]