StarFunc result for job id Q7Z4H4

User Input

>input (148 residues)
MARIPTAALGCISLLCLQLPGSLSRSLGGDPRPVKPREPPARSPSSSLQPRHPAPRPVVW
KLHRALQAQRGAGLAPVMGQPLRDGGRQHSGPRRHSGPRRTQAQLLRVGCVLGTCQVQNL
SHRLWQLMGPAGRQDSAPVDPSSPHSYG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z4H4	0.999	0.999	5.377E-22	148	1.000	1.000	Q7Z4H4.pdb.gz	ADM2_HUMAN Protein ADM2 OS=Homo sapiens OX=9606 GN=ADM2 PE=1 SV=1
2	AFDB:P61312	0.394	0.398	2.165E-10	146	0.622	0.630	P61312.pdb.gz	ADM2_RAT Protein ADM2 OS=Rattus norvegicus OX=10116 GN=Adm2 PE=1 SV=1
3	AFDB:A0A076NBC4	0.169	0.048	1.668	699	0.182	0.039	A0A076NBC4.pdb.gz	A0A076NBC4_MOUSE Truncated Kidins220 isoform m3 (Fragment) OS=Mus musculus OX=10090 GN=Kidins220 PE=2 SV=1
4	AFDB:Q95T64	0.153	0.076	2.202	368	0.162	0.065	Q95T64.pdb.gz	PGPLA_DROME Peptidoglycan-recognition protein LA OS=Drosophila melanogaster OX=7227 GN=PGRP-LA PE=1 SV=2
5	AFDB:F7E8Q2	0.203	0.166	3.837	196	0.216	0.163	F7E8Q2.pdb.gz	F7E8Q2_MACMU Corticotropin releasing hormone OS=Macaca mulatta OX=9544 GN=CRH PE=3 SV=1
6	AFDB:P14209	0.136	0.113	4.408	185	0.223	0.178	P14209.pdb.gz	CD99_HUMAN CD99 antigen OS=Homo sapiens OX=9606 GN=CD99 PE=1 SV=1
7	AFDB:P01213	0.137	0.092	4.725	254	0.115	0.067	P01213.pdb.gz	PDYN_HUMAN Proenkephalin-B OS=Homo sapiens OX=9606 GN=PDYN PE=1 SV=1
8	AFDB:A0A1D8PGE3	0.152	0.068	5.065	416	0.169	0.060	A0A1D8PGE3.pdb.gz	A0A1D8PGE3_CANAL UV excision repair protein RAD23 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=RAD23 PE=3 SV=1
9	AFDB:A6NI15	0.129	0.101	5.065	193	0.135	0.104	A6NI15.pdb.gz	MSGN1_HUMAN Mesogenin-1 OS=Homo sapiens OX=9606 GN=MSGN1 PE=1 SV=1
10	AFDB:Q38EJ9	0.143	0.056	5.065	504	0.149	0.044	Q38EJ9.pdb.gz	Q38EJ9_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5490 PE=4 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z4H4	1.84e-100	286	148	1.000	1.000	ADM2_HUMAN Protein ADM2 OS=Homo sapiens OX=9606 GN=ADM2 PE=1 SV=1
2	P61312	4.45e-49	156	146	0.622	0.630	ADM2_RAT Protein ADM2 OS=Rattus norvegicus OX=10116 GN=Adm2 PE=1 SV=1
3	P35318	0.006	37.7	185	0.115	0.092	ADML_HUMAN Pro-adrenomedullin OS=Homo sapiens OX=9606 GN=ADM PE=1 SV=1
4	P97297	0.033	35.4	184	0.108	0.087	ADML_MOUSE Pro-adrenomedullin OS=Mus musculus OX=10090 GN=Adm PE=2 SV=2
5	P43145	0.035	35.4	185	0.101	0.081	ADML_RAT Pro-adrenomedullin OS=Rattus norvegicus OX=10116 GN=Adm PE=1 SV=1
6	O00160	0.63	32.3	1098	0.196	0.026	MYO1F_HUMAN Unconventional myosin-If OS=Homo sapiens OX=9606 GN=MYO1F PE=1 SV=3
7	Q05A80	1.7	30.8	1031	0.128	0.018	CAPR2_MOUSE Caprin-2 OS=Mus musculus OX=10090 GN=Caprin2 PE=1 SV=1
8	Q6IMN6	2.2	30.8	1127	0.122	0.016	CAPR2_HUMAN Caprin-2 OS=Homo sapiens OX=9606 GN=CAPRIN2 PE=1 SV=1
9	Q03356	3.3	29.6	257	0.115	0.066	MSXB_DANRE Homeobox protein MSH-B OS=Danio rerio OX=7955 GN=msxb PE=2 SV=3
10	Q54BM2	3.5	30.0	565	0.115	0.030	PAP1A_DICDI Polyadenylate-binding protein 1-A OS=Dictyostelium discoideum OX=44689 GN=pabpc1A PE=1 SV=1
11	B7G620	7.9	28.9	548	0.088	0.024	IDH1_PHATC Isocitrate dehydrogenase [NAD(+)] 1, mitochondrial OS=Phaeodactylum tricornutum (strain CCAP 1055/1) OX=556484 GN=IDH1 PE=1 SV=2
12	Q4V8F6	10.0	28.5	335	0.135	0.060	Q4V8F6_RAT Pcbp2 protein OS=Rattus norvegicus OX=10116 GN=Pcbp2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00214 Calc_CGRP_IAPP	0.0059	28.6	Calcitonin / CGRP / IAPP family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000379087

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000386972	0.991	Calcitonin gene-related peptide type 1 receptor
2	9606.ENSP00000242249	0.986	Receptor activity-modifying protein 3
3	9606.ENSP00000253796	0.940	Receptor activity-modifying protein 2
4	9606.ENSP00000436607	0.923	ADM
5	9606.ENSP00000254661	0.899	Receptor activity-modifying protein 1
6	9606.ENSP00000331746	0.876	Calcitonin
7	9606.ENSP00000240652	0.854	Islet amyloid polypeptide
8	9606.ENSP00000384092	0.825	Pro-opiomelanocortin
9	9606.ENSP00000360141	0.809	Guanine nucleotide-binding protein G(s) subunit alpha isoforms XLas
10	9606.ENSP00000393631	0.803	Putative adrenomedullin-5-like protein
11	9606.ENSP00000334448	0.800	Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-2
12	9606.ENSP00000481878	0.800	Guanine nucleotide-binding protein G(I)/G(S)/G(T) subunit beta-1
13	9606.ENSP00000433490	0.792	Calcitonin gene-related peptide 2
14	9606.ENSP00000216075	0.789	Belongs to the myo-inositol oxygenase family.
15	9606.ENSP00000352561	0.781	Calcitonin receptor
16	9606.ENSP00000330572	0.733	C-Jun-amino-terminal kinase-interacting protein 2
17	9606.ENSP00000361140	0.732	Alcohol dehydrogenase [NADP(+)]
18	9606.ENSP00000346206	0.648	Antigen peptide transporter 1
19	9606.ENSP00000384515	0.648	Beta-parvin
20	9606.ENSP00000176195	0.635	Secretin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0044877	0.999	protein-containing complex binding
GO:0005102	0.999	signaling receptor binding
GO:0001664	0.785	G protein-coupled receptor binding
GO:0098772	0.648	molecular function regulator activity
GO:0140677	0.574	molecular function activator activity
GO:0048018	0.518	receptor ligand activity
GO:0005179	0.312	hormone activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0009987	0.994	cellular process
GO:0032502	0.966	developmental process
GO:0050794	0.962	regulation of cellular process
GO:0048856	0.954	anatomical structure development
GO:0032501	0.949	multicellular organismal process
GO:0007275	0.933	multicellular organism development
GO:0050896	0.923	response to stimulus
GO:0048518	0.917	positive regulation of biological process
GO:0051716	0.887	cellular response to stimulus
GO:0048731	0.887	system development
GO:0009893	0.879	positive regulation of metabolic process
GO:0060255	0.877	regulation of macromolecule metabolic process
GO:0007165	0.876	signal transduction
GO:0010468	0.872	regulation of gene expression
GO:0010604	0.861	positive regulation of macromolecule metabolic process
GO:0051239	0.713	regulation of multicellular organismal process
GO:0007186	0.700	G protein-coupled receptor signaling pathway
GO:0008152	0.676	metabolic process
GO:0071704	0.653	organic substance metabolic process
GO:0007189	0.628	adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0044237	0.577	cellular metabolic process
GO:0009653	0.527	anatomical structure morphogenesis
GO:0044238	0.482	primary metabolic process
GO:0051240	0.467	positive regulation of multicellular organismal process
GO:0065008	0.437	regulation of biological quality
GO:0010628	0.431	positive regulation of gene expression
GO:0006807	0.395	nitrogen compound metabolic process
GO:0001944	0.380	vasculature development
GO:0050793	0.374	regulation of developmental process
GO:0048514	0.365	blood vessel morphogenesis
GO:0001525	0.344	angiogenesis
GO:1901564	0.340	organonitrogen compound metabolic process
GO:0043170	0.337	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	1.000	extracellular region
GO:0005622	0.748	intracellular anatomical structure
GO:0005737	0.735	cytoplasm
GO:0005615	0.585	extracellular space
GO:0043227	0.343	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]