StarFunc result for job id Q7Z4L5

User Input

>input (1316 residues)
MDSQELKTLINYYCQERYFHHVLLVASEGIKRYGSDPVFRFYHAYGTLMEGKTQEALREF
EAIKNKQDVSLCSLLALIYAHKMSPNPDREAILESDARVKEQRKGAGEKALYHAGLFLWH
IGRHDKAREYIDRMIKISDGSKQGHVLKAWLDITRGKEPYTKKALKYFEEGLQDGNDTFA
LLGKAQCLEMRQNYSGALETVNQIIVNFPSFLPAFVKKMKLQLALQDWDQTVETAQRLLL
QDSQNVEALRMQALYYVCREGDIEKASTKLENLGNTLDAMEPQNAQLFYNITLAFSRTCG
RSQLILQKIQTLLERAFSLNPQQSEFATELGYQMILQGRVKEALKWYKTAMTLDETSVSA
LVGFIQCQLIEGQLQDADQQLEFLNEIQQSIGKSAELIYLHAVLAMKKNKRQEEVINLLN
DVLDTHFSQLEGLPLGIQYFEKLNPDFLLEIVMEYLSFCPMQPASPGQPLCPLLRRCISV
LETVVRTVPGLLQTVFLIAKVKYLSGDIEAAFNNLQHCLEHNPSYADAHLLLAQVYLSQE
KVKLCSQSLELCLSYDFKVRDYPLYHLIKAQSQKKMGEIADAIKTLHMAMSLPGMKRIGA
STKSKDRKTEVDTSHRLSIFLELIDVHRLNGEQHEATKVLQDAIHEFSGTSEEVRVTIAN
ADLALAQGDIERALSILQNVTAEQPYFIEAREKMADIYLKHRKDKMLYITCFREIAERMA
NPRSFLLLGDAYMNILEPEEAIVAYEQALNQNPKDGTLASKMGKALIKTHNYSMAITYYE
AALKTGQKNYLCYDLAELLLKLKWYDKAEKVLQHALAHEPVNELSALMEDGRCQVLLAKV
YSKMEKLGDAITALQQARELQARVLKRVQMEQPDAVPAQKHLAAEICAEIAKHSVAQRDY
EKAIKFYREALVHCETDNKIMLELARLYLAQDDPDSCLRQCALLLQSDQDNEAATMMMAD
LMFRKQDYEQAVFHLQQLLERKPDNYMTLSRLIDLLRRCGKLEDVPRFFSMAEKRNSRAK
LEPGFQYCKGLYLWYTGEPNDALRHFNKARKDRDWGQNALYNMIEICLNPDNETVGGEVF
ENLDGDLGNSTEKQESVQLAVRTAEKLLKELKPQTVQGHVQLRIMENYCLMATKQKSNVE
QALNTFTEIAASEKEHIPALLGMATAYMILKQTPRARNQLKRIAKMNWNAIDAEEFEKSW
LLLADIYIQSAKYDMAEDLLKRCLRHNRSCCKAYEYMGYIMEKEQAYTDAALNYEMAWKY
SNRTNPAVGYKLAFNYLKAKRYVDSIDICHQVLEAHPTYPKIRKDILDKARASLRP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:B0R0W1	0.984	0.980	0.000	1321	0.682	0.680	B0R0W1.pdb.gz	B0R0W1_DANRE Tetratricopeptide repeat domain 21B OS=Danio rerio OX=7955 GN=sb:cb947 PE=1 SV=1
2	AFDB:Q0HA38	0.924	0.925	0.000	1315	0.858	0.859	Q0HA38.pdb.gz	TT21B_MOUSE Tetratricopeptide repeat protein 21B OS=Mus musculus OX=10090 GN=Ttc21b PE=1 SV=1
3	AFDB:Q7Z4L5	1.000	1.000	0.000	1316	1.000	1.000	Q7Z4L5.pdb.gz	TT21B_HUMAN Tetratricopeptide repeat protein 21B OS=Homo sapiens OX=9606 GN=TTC21B PE=1 SV=2
4	AFDB:Q8C0S4	0.737	0.738	2.042E-95	1314	0.514	0.514	Q8C0S4.pdb.gz	TT21A_MOUSE Tetratricopeptide repeat protein 21A OS=Mus musculus OX=10090 GN=Ttc21a PE=1 SV=2
5	AFDB:Q8NDW8	0.906	0.903	2.042E-95	1320	0.513	0.511	Q8NDW8.pdb.gz	TT21A_HUMAN Tetratricopeptide repeat protein 21A OS=Homo sapiens OX=9606 GN=TTC21A PE=1 SV=3
6	AFDB:Q38EI1	0.795	0.777	4.443E-65	1351	0.312	0.303	Q38EI1.pdb.gz	Q38EI1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5670 PE=3 SV=1
7	AFDB:Q6PGP7	0.191	0.165	4.044E-22	1564	0.128	0.107	Q6PGP7.pdb.gz	SKI3_HUMAN Superkiller complex protein 3 OS=Homo sapiens OX=9606 GN=SKIC3 PE=1 SV=1
8	AFDB:Q54HV0	0.208	0.161	1.190E-20	1825	0.153	0.110	Q54HV0.pdb.gz	Q54HV0_DICDI Tetratricopeptide-like helical domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DG1091 PE=4 SV=1
9	AFDB:O94474	0.189	0.181	4.229E-20	1389	0.123	0.117	O94474.pdb.gz	SKI3_SCHPO Superkiller protein 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=ski3 PE=3 SV=1
10	AFDB:Q6NNB2	0.202	0.212	4.381E-20	1233	0.128	0.137	Q6NNB2.pdb.gz	Q6NNB2_DROME LP07472p OS=Drosophila melanogaster OX=7227 GN=SKI3 PE=1 SV=1
11	PDB:7qdrB	0.272	0.291	6.176E-18	1212	0.129	0.140	7qdrB.pdb.gz
12	PDB:4bujB	0.180	0.177	7.903E-18	1367	0.126	0.121	4bujB.pdb.gz
13	PDB:7dkhI	0.186	0.247	3.183E-13	914	0.090	0.130	7dkhI.pdb.gz
14	PDB:6tedQ	0.220	0.282	4.795E-12	890	0.123	0.182	6tedQ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
15	PDB:6bq1B	0.136	0.203	2.310E-10	728	0.087	0.157	6bq1B.pdb.gz	Architecture of the human PI4KIII alpha lipid kinase complex.
16	PDB:7sqcR1	0.179	0.141	1.127E-9	2080	0.152	0.096	7sqcR1.pdb.gz	Ciliary central apparatus structure reveals mechanisms of microtubule patterning.
17	PDB:5dseA	0.189	0.373	3.023E-9	537	0.065	0.160	5dseA.pdb.gz
18	PDB:4kvmB	0.147	0.242	3.735E-9	722	0.083	0.151	4kvmB.pdb.gz	Molecular basis for N-terminal acetylation by the heterodimeric NatA complex.
19	PDB:7ntfA	0.189	0.252	4.300E-9	918	0.056	0.081	7ntfA.pdb.gz
20	PDB:7n6g1N	0.166	0.124	5.502E-9	2179	0.147	0.089	7n6g1N.pdb.gz	Cryo-EM structure of an active central apparatus.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0B4J1Y2	0.0	1131	1143	0.426	0.490	A0A0B4J1Y2_HUMAN Tetratricopeptide repeat domain 21A OS=Homo sapiens OX=9606 GN=TTC21A PE=1 SV=1
2	A9XPA6	0.0	910	1355	0.387	0.376	A9XPA6_CHLRE Intraflagellar transport protein 139 OS=Chlamydomonas reinhardtii OX=3055 GN=IFT139 PE=1 SV=1
3	B0R0W1	0.0	1920	1321	0.682	0.680	B0R0W1_DANRE Tetratricopeptide repeat domain 21B OS=Danio rerio OX=7955 GN=sb:cb947 PE=1 SV=1
4	Q0HA38	0.0	2363	1315	0.859	0.859	TT21B_MOUSE Tetratricopeptide repeat protein 21B OS=Mus musculus OX=10090 GN=Ttc21b PE=1 SV=1
5	Q38EI1	0.0	625	1351	0.317	0.309	Q38EI1_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.5670 PE=3 SV=1
6	Q7Z4L5	0.0	2730	1316	1.000	1.000	TT21B_HUMAN Tetratricopeptide repeat protein 21B OS=Homo sapiens OX=9606 GN=TTC21B PE=1 SV=2
7	Q8C0S4	0.0	1369	1314	0.517	0.518	TT21A_MOUSE Tetratricopeptide repeat protein 21A OS=Mus musculus OX=10090 GN=Ttc21a PE=1 SV=2
8	Q8NDW8	0.0	1384	1320	0.514	0.512	TT21A_HUMAN Tetratricopeptide repeat protein 21A OS=Homo sapiens OX=9606 GN=TTC21A PE=1 SV=3
9	Q9M8Y0	3.52e-05	50.8	977	0.060	0.081	SEC_ARATH Probable UDP-N-acetylglucosamine--peptide N-acetylglucosaminyltransferase SEC OS=Arabidopsis thaliana OX=3702 GN=SEC PE=1 SV=1
10	Q9I7L8	7.06e-04	46.6	678	0.035	0.068	Q9I7L8_DROME Cell division cycle 23, isoform A OS=Drosophila melanogaster OX=7227 GN=Cdc23 PE=2 SV=2
11	O51213	0.001	45.1	379	0.043	0.148	O51213_BORBU TPR domain protein OS=Borreliella burgdorferi (strain ATCC 35210 / DSM 4680 / CIP 102532 / B31) OX=224326 GN=BB_0195 PE=4 SV=1
12	O94556	0.002	44.7	565	0.042	0.097	APC8_SCHPO Anaphase-promoting complex subunit 8 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=cut23 PE=1 SV=2
13	P73091	0.006	43.1	398	0.046	0.151	P73091_SYNY3 Slr2048 protein OS=Synechocystis sp. (strain PCC 6803 / Kazusa) OX=1111708 GN=slr2048 PE=4 SV=1
14	Q8IUR5	0.006	43.5	882	0.040	0.059	TMTC1_HUMAN Protein O-mannosyl-transferase TMTC1 OS=Homo sapiens OX=9606 GN=TMTC1 PE=1 SV=3
15	B3DNN5	0.015	42.0	543	0.030	0.072	CDC16_ARATH Anaphase-promoting complex subunit 6 OS=Arabidopsis thaliana OX=3702 GN=APC6 PE=2 SV=1
16	P38042	0.027	41.2	758	0.030	0.053	CDC27_YEAST Anaphase-promoting complex subunit CDC27 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=CDC27 PE=1 SV=2
17	Q387Q5	0.037	40.4	425	0.024	0.075	Q387Q5_TRYB2 peptidylprolyl isomerase OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.61.0180 PE=4 SV=1
18	Q9UJX3	0.039	40.8	565	0.032	0.074	APC7_HUMAN Anaphase-promoting complex subunit 7 OS=Homo sapiens OX=9606 GN=ANAPC7 PE=1 SV=5
19	P10505	0.045	40.4	665	0.036	0.071	APC3_SCHPO Anaphase-promoting complex subunit 3 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=nuc2 PE=1 SV=3
20	Q389Z5	0.055	39.7	301	0.018	0.080	Q389Z5_TRYB2 Tetratricopeptide repeat protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.0500 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14863 Alkyl_sulf_dimr	1.9	20.3	Alkyl sulfatase dimerisation
2	PF12895 ANAPC3	1.9e-15	68.2	Anaphase-promoting complex, cyclosome, subunit 3
3	PF20225 DUF6584	1.1	20.7	Family of unknown function (DUF6584)
4	PF14853 Fis1_TPR_C	0.0016	29.9	Fis1 C-terminal tetratricopeptide repeat
5	PF16918 PknG_TPR	0.0027	28.2	Protein kinase G tetratricopeptide repeat
6	PF01535 PPR	0.94	21.0	PPR repeat
7	PF14689 SPOB_a	61	14.7	Sensor_kinase_SpoOB-type, alpha-helical domain
8	PF00515 TPR_1	2.8e-25	98.2	Tetratricopeptide repeat
9	PF13374 TPR_10	0.0018	29.3	Tetratricopeptide repeat
10	PF13414 TPR_11	2.8e-13	60.6	TPR repeat
11	PF13424 TPR_12	3.2e-13	61.1	Tetratricopeptide repeat
12	PF13428 TPR_14	2.8e-38	138.2	Tetratricopeptide repeat
13	PF13432 TPR_16	9.7e-23	91.8	Tetratricopeptide repeat
14	PF13431 TPR_17	3.1e-07	41.4	Tetratricopeptide repeat
15	PF14559 TPR_19	1.3e-46	168.2	Tetratricopeptide repeat
16	PF07719 TPR_2	6.3e-38	136.9	Tetratricopeptide repeat
17	PF14561 TPR_20	1.2	20.9	Tetratricopeptide repeat
18	PF09976 TPR_21	1.3e-07	43.1	Tetratricopeptide repeat-like domain
19	PF07721 TPR_4	12	17.9	Tetratricopeptide repeat
20	PF13174 TPR_6	8.6e-08	43.5	Tetratricopeptide repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000243344

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382717	0.996	WD repeat-containing protein 19
2	9606.ENSP00000406012	0.996	Intraflagellar transport protein 140 homolog
3	9606.ENSP00000238628	0.995	Intraflagellar transport proteins
4	9606.ENSP00000296266	0.994	Intraflagellar transport protein 122 homolog
5	9606.ENSP00000314444	0.994	WD repeat-containing protein 35
6	9606.ENSP00000393541	0.968	Intraflagellar transport protein 27 homolog
7	9606.ENSP00000404122	0.966	Intraflagellar transport protein 74 homolog
8	9606.ENSP00000242591	0.964	Intraflagellar transport protein 81 homolog
9	9606.ENSP00000312778	0.961	Intraflagellar transport protein 80 homolog
10	9606.ENSP00000260570	0.958	Intraflagellar transport protein 172 homolog
11	9606.ENSP00000358918	0.958	Suppressor of fused homolog
12	9606.ENSP00000379258	0.947	Transcriptional activator GLI3
13	9606.ENSP00000390436	0.946	Zinc finger protein GLI2
14	9606.ENSP00000380321	0.944	Tubby-related protein 3
15	9606.ENSP00000323580	0.940	Intraflagellar transport protein 88 homolog
16	9606.ENSP00000228682	0.938	Zinc finger protein GLI1
17	9606.ENSP00000264020	0.937	Intraflagellar transport proteins
18	9606.ENSP00000381167	0.934	Cytoplasmic dynein 2 heavy chain 1
19	9606.ENSP00000264538	0.933	Intraflagellar transport protein 57 homolog
20	9606.ENSP00000362121	0.929	Intraflagellar transport protein 52 homolog

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003682	0.648	chromatin binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.991	cellular process
GO:0050789	0.975	regulation of biological process
GO:0051641	0.958	cellular localization
GO:0050794	0.922	regulation of cellular process
GO:0061512	0.875	protein localization to cilium
GO:0032501	0.659	multicellular organismal process
GO:0032502	0.538	developmental process
GO:0048856	0.525	anatomical structure development
GO:0019222	0.521	regulation of metabolic process
GO:0071840	0.477	cellular component organization or biogenesis
GO:0016043	0.456	cellular component organization
GO:0060255	0.372	regulation of macromolecule metabolic process
GO:0006996	0.304	organelle organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0030990	0.999	intraciliary transport particle
GO:0043227	0.969	membrane-bounded organelle
GO:0005929	0.932	cilium
GO:0043232	0.893	intracellular non-membrane-bounded organelle
GO:0097542	0.818	ciliary tip
GO:0005737	0.706	cytoplasm
GO:0030991	0.629	intraciliary transport particle A
GO:0016020	0.327	membrane
GO:0005829	0.301	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]