StarFunc result for job id Q7Z4N2

User Input

>input (1603 residues)
MKDSNRCCCGQFTNQHIPPLPSATPSKNEEESKQVETQPEKWSVAKHTQSYPTDSYGVLE
FQGGGYSNKAMYIRVSYDTKPDSLLHLMVKDWQLELPKLLISVHGGLQNFEMQPKLKQVF
GKGLIKAAMTTGAWIFTGGVSTGVISHVGDALKDHSSKSRGRVCAIGIAPWGIVENKEDL
VGKDVTRVYQTMSNPLSKLSVLNNSHTHFILADNGTLGKYGAEVKLRRLLEKHISLQKIN
TRLGQGVPLVGLVVEGGPNVVSIVLEYLQEEPPIPVVICDGSGRASDILSFAHKYCEEGG
IINESLREQLLVTIQKTFNYNKAQSHQLFAIIMECMKKKELVTVFRMGSEGQQDIEMAIL
TALLKGTNVSAPDQLSLALAWNRVDIARSQIFVFGPHWPPLGSLAPPTDSKATEKEKKPP
MATTKGGRGKGKGKKKGKVKEEVEEETDPRKIELLNWVNALEQAMLDALVLDRVDFVKLL
IENGVNMQHFLTIPRLEELYNTRLGPPNTLHLLVRDVKKSNLPPDYHISLIDIGLVLEYL
MGGAYRCNYTRKNFRTLYNNLFGPKRPKALKLLGMEDDEPPAKGKKKKKKKKEEEIDIDV
DDPAVSRFQYPFHELMVWAVLMKRQKMAVFLWQRGEESMAKALVACKLYKAMAHESSESD
LVDDISQDLDNNSKDFGQLALELLDQSYKHDEQIAMKLLTYELKNWSNSTCLKLAVAAKH
RDFIAHTCSQMLLTDMWMGRLRMRKNPGLKVIMGILLPPTILFLEFRTYDDFSYQTSKEN
EDGKEKEEENTDANADAGSRKGDEENEHKKQRSIPIGTKICEFYNAPIVKFWFYTISYLG
YLLLFNYVILVRMDGWPSLQEWIVISYIVSLALEKIREILMSEPGKLSQKIKVWLQEYWN
ITDLVAISTFMIGAILRLQNQPYMGYGRVIYCVDIIFWYIRVLDIFGVNKYLGPYVMMIG
KMMIDMLYFVVIMLVVLMSFGVARQAILHPEEKPSWKLARNIFYMPYWMIYGEVFADQID
LYAMEINPPCGENLYDEEGKRLPPCIPGAWLTPALMACYLLVANILLVNLLIAVFNNTFF
EVKSISNQVWKFQRYQLIMTFHDRPVLPPPMIILSHIYIIIMRLSGRCRKKREGDQEERD
RGLKLFLSDEELKRLHEFEEQCVQEHFREKEDEQQSSSDERIRVTSERVENMSMRLEEIN
ERETFMKTSLQTVDLRLAQLEELSNRMVNALENLAGIDRSDLIQARSRASSECEATYLLR
QSSINSADGYSLYRYHFNGEELLFEDTSLSTSPGTGVRKKTCSFRIKEEKDVKTHLVPEC
QNSLHLSLGTSTSATPDGSHLAVDDLKNAEESKLGPDIGISKEDDERQTDSKKEETISPS
LNKTDVIHGQDKSDVQNTQLTVETTNIEGTISYPLEETKITRYFPDETINACKTMKSRSF
VYSRGRKLVGGVNQDVEYSSITDQQLTTEWQCQVQKITRSHSTDIPYIVSEAAVQAEHKE
QFADMQDEHHVAEAIPRIPRLSLTITDRNGMENLLSVKPDQTLGFPSLRSKSLHGHPRNV
KSIQGKLDRSGHASSVSSLVIVSGMTAEEKKVKKEKASTETEC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q2TV84	0.792	0.782	0.000	1622	0.865	0.855	Q2TV84.pdb.gz	TRPM1_MOUSE Transient receptor potential cation channel subfamily M member 1 OS=Mus musculus OX=10090 GN=Trpm1 PE=1 SV=2
2	AFDB:Q7Z4N2	1.000	1.000	0.000	1603	1.000	1.000	Q7Z4N2.pdb.gz	TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens OX=9606 GN=TRPM1 PE=1 SV=2
3	AFDB:Q96QT4	0.659	0.569	0.000	1865	0.445	0.383	Q96QT4.pdb.gz	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1
4	AFDB:Q9BX84	0.655	0.523	0.000	2022	0.434	0.344	Q9BX84.pdb.gz	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
5	AFDB:Q9HCF6	0.716	0.664	0.000	1732	0.609	0.564	Q9HCF6.pdb.gz	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
6	AFDB:Q8CIR4	0.655	0.521	7.915E-104	2028	0.415	0.328	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
7	AFDB:A8DYE2	0.655	0.522	2.535E-99	2023	0.384	0.304	A8DYE2.pdb.gz	TRPCG_DROME Transient receptor potential cation channel trpm OS=Drosophila melanogaster OX=7227 GN=Trpm PE=1 SV=1
8	AFDB:A0A2R8PXP3	0.630	0.568	1.371E-92	1787	0.369	0.331	A0A2R8PXP3.pdb.gz
9	PDB:6co7A	0.559	0.826	1.089E-64	1061	0.226	0.342	6co7A.pdb.gz	Structure of a TRPM2 channel in complex with Ca2+explains unique gating regulation.
10	PDB:6puuA	0.537	0.649	2.505E-56	1309	0.215	0.263	6puuA.pdb.gz	Ligand recognition and gating mechanism through three ligand-binding sites of human TRPM2 channel.
11	PDB:6bcqB	0.500	0.776	5.211E-52	983	0.200	0.327	6bcqB.pdb.gz	Structures of the calcium-activated, non-selective cation channel TRPM4.
12	PDB:6drjA	0.466	0.569	2.775E-49	1266	0.221	0.280	6drjA.pdb.gz	Architecture of the TRPM2 channel and its activation mechanism by ADP-ribose and calcium.
13	PDB:6bqrA	0.490	0.790	6.269E-48	948	0.192	0.325	6bqrA.pdb.gz	Structure of the human TRPM4 ion channel in a lipid nanodisc.
14	PDB:6pkxB	0.463	0.586	1.477E-46	1218	0.216	0.284	6pkxB.pdb.gz	Visualizing structural transitions of ligand-dependent gating of the TRPM2 channel.
15	PDB:5wp6A	0.495	0.772	3.028E-43	977	0.200	0.329	5wp6A.pdb.gz	Electron cryo-microscopy structure of a human TRPM4 channel.
16	PDB:8e4nA	0.439	0.732	3.028E-43	901	0.170	0.303	8e4nA.pdb.gz	Activation mechanism of the mouse cold-sensing TRPM8 channel by cooling agonist and PIP 2.
17	PDB:7wrbA	0.442	0.718	5.462E-43	930	0.176	0.303	7wrbA.pdb.gz	Structures of a mammalian TRPM8 in closed state.
18	PDB:6mj2A	0.492	0.576	5.942E-43	1337	0.216	0.260	6mj2A.pdb.gz	Structures and gating mechanism of human TRPM2.
19	AFDB:Q14152	0.073	0.080	4.877E-5	1382	0.120	0.139	Q14152.pdb.gz	EIF3A_HUMAN Eukaryotic translation initiation factor 3 subunit A OS=Homo sapiens OX=9606 GN=EIF3A PE=1 SV=1
20	AFDB:Q5AAF4	0.052	0.054	1.458E-4	1485	0.075	0.081	Q5AAF4.pdb.gz	BNR1_CANAL Formin BNR1 OS=Candida albicans (strain SC5314 / ATCC MYA-2876) OX=237561 GN=BNR1 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8DYE2	0.0	1099	2023	0.355	0.281	TRPCG_DROME Transient receptor potential cation channel trpm OS=Drosophila melanogaster OX=7227 GN=Trpm PE=1 SV=1
2	Q2TV84	0.0	2749	1622	0.862	0.852	TRPM1_MOUSE Transient receptor potential cation channel subfamily M member 1 OS=Mus musculus OX=10090 GN=Trpm1 PE=1 SV=2
3	Q563W7	0.0	846	1774	0.273	0.246	Q563W7_DANRE non-specific serine/threonine protein kinase OS=Danio rerio OX=7955 GN=tct PE=2 SV=1
4	Q7Z4N2	0.0	3338	1603	1.000	1.000	TRPM1_HUMAN Transient receptor potential cation channel subfamily M member 1 OS=Homo sapiens OX=9606 GN=TRPM1 PE=1 SV=2
5	Q8CIR4	0.0	799	2028	0.258	0.204	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
6	Q923J1	0.0	1219	1863	0.397	0.342	TRPM7_MOUSE Transient receptor potential cation channel subfamily M member 7 OS=Mus musculus OX=10090 GN=Trpm7 PE=1 SV=1
7	Q925B3	0.0	1215	1862	0.397	0.342	TRPM7_RAT Transient receptor potential cation channel subfamily M member 7 OS=Rattus norvegicus OX=10116 GN=Trpm7 PE=1 SV=2
8	Q96QT4	0.0	1206	1865	0.391	0.336	TRPM7_HUMAN Transient receptor potential cation channel subfamily M member 7 OS=Homo sapiens OX=9606 GN=TRPM7 PE=1 SV=1
9	Q9BX84	0.0	842	2022	0.268	0.212	TRPM6_HUMAN Transient receptor potential cation channel subfamily M member 6 OS=Homo sapiens OX=9606 GN=TRPM6 PE=1 SV=2
10	Q9HCF6	0.0	1261	1732	0.424	0.392	TRPM3_HUMAN Transient receptor potential cation channel subfamily M member 3 OS=Homo sapiens OX=9606 GN=TRPM3 PE=1 SV=4
11	A0A0R4IMY7	1.17e-149	498	1470	0.247	0.269	TRPM2_DANRE Transient receptor potential cation channel subfamily M member 2 OS=Danio rerio OX=7955 GN=trpm2 PE=1 SV=2
12	Q20766	8.35e-125	427	1406	0.173	0.197	Q20766_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gtl-2 PE=4 SV=5
13	G5EGP7	2.47e-102	366	1971	0.118	0.096	G5EGP7_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=1
14	Q93971	3.02e-102	366	2032	0.118	0.093	TRPG_CAEEL Transient receptor potential channel OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=4
15	G5EE91	3.97e-102	365	1931	0.118	0.098	G5EE91_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=1
16	A7T1N0	9.17e-102	362	1551	0.154	0.159	TMP2L_NEMVE Transient receptor potential cation channel subfamily M member-like 2 OS=Nematostella vectensis OX=45351 GN=TRPM2 PE=1 SV=1
17	G5ECM4	5.12e-97	348	1694	0.103	0.097	G5ECM4_CAEEL GTL-1 OS=Caenorhabditis elegans OX=6239 GN=gtl-1 PE=1 SV=1
18	S5TRY1	2.80e-88	318	1260	0.157	0.200	S5TRY1_DANRE Transient receptor potential cation channel, subfamily M, member 4a OS=Danio rerio OX=7955 GN=TRPM4a PE=2 SV=1
19	G5EGJ6	4.71e-86	314	1626	0.095	0.094	G5EGJ6_CAEEL LSDAT_euk domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=gon-2 PE=1 SV=1
20	Q9NZQ8	1.74e-83	302	1165	0.144	0.198	TRPM5_HUMAN Transient receptor potential cation channel subfamily M member 5 OS=Homo sapiens OX=9606 GN=TRPM5 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF04399 Glutaredoxin2_C	7e+02	11.4	Glutaredoxin 2, C terminal domain
2	PF00520 Ion_trans	2.5e-16	71.2	Ion transport protein
3	PF18139 LSDAT_euk	3e-116	399.0	SLOG in TRPM
4	PF18171 LSDAT_prok	1.2e-12	59.0	SLOG in TRPM, prokaryote
5	PF16519 TRPM_tetra	1.7e-20	84.1	Tetramerisation domain of TRPM

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000437849

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000340328	0.942	Nyctalopin
2	9606.ENSP00000231188	0.833	Metabotropic glutamate receptor 6
3	9606.ENSP00000483469	0.828	Probable G-protein coupled receptor 179
4	9606.ENSP00000469759	0.788	Leucine-rich repeat, immunoglobulin-like domain and transmembrane domain-containing protein 3
5	9606.ENSP00000402537	0.765	Myotubularin-related protein 10
6	9606.ENSP00000264079	0.737	Mucolipin-1
7	9606.ENSP00000352358	0.735	Transient receptor potential cation channel subfamily V member 6
8	9606.ENSP00000459962	0.735	Transient receptor potential cation channel, subfamily V, member 1
9	9606.ENSP00000461007	0.735	Transient receptor potential cation channel subfamily V member 1
10	9606.ENSP00000325296	0.698	Polycystic kidney disease 2-like 1 protein
11	9606.ENSP00000380876	0.687	Regulator of G-protein signaling 11
12	9606.ENSP00000262209	0.684	Transient receptor potential cation channel subfamily A member 1
13	9606.ENSP00000354497	0.674	Fanconi-associated nuclease 1
14	9606.ENSP00000342222	0.670	Transient receptor potential cation channel subfamily V member 2
15	9606.ENSP00000365441	0.664	Voltage-dependent L-type calcium channel subunit alpha-1F
16	9606.ENSP00000359621	0.661	Mucolipin-3
17	9606.ENSP00000265310	0.655	Transient receptor potential cation channel subfamily V member 5
18	9606.ENSP00000406191	0.654	Transient receptor potential cation channel subfamily V member 4
19	9606.ENSP00000305926	0.640	OTU domain-containing protein 7A
20	9606.ENSP00000301365	0.638	Transient receptor potential cation channel subfamily V member 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005262	1.000	calcium channel activity
GO:0005515	0.995	protein binding
GO:0022836	0.510	gated channel activity
GO:0022839	0.392	monoatomic ion gated channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.989	biological regulation
GO:0006816	0.986	calcium ion transport
GO:0070588	0.978	calcium ion transmembrane transport
GO:0032501	0.944	multicellular organismal process
GO:0050896	0.925	response to stimulus
GO:0050789	0.917	regulation of biological process
GO:0050794	0.903	regulation of cellular process
GO:0009628	0.879	response to abiotic stimulus
GO:0051716	0.860	cellular response to stimulus
GO:0104004	0.723	cellular response to environmental stimulus
GO:0023052	0.690	signaling
GO:0007154	0.688	cell communication
GO:0003008	0.607	system process
GO:0007165	0.580	signal transduction
GO:0009416	0.477	response to light stimulus
GO:0007600	0.391	sensory perception
GO:0071482	0.340	cellular response to light stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	0.998	plasma membrane
GO:0005622	0.712	intracellular anatomical structure
GO:0005737	0.612	cytoplasm
GO:0043229	0.488	intracellular organelle
GO:0043227	0.301	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	1.000	Ca(2+)(in) = Ca(2+)(out)

[back to server]