StarFunc result for job id Q7Z4P5

User Input

>input (450 residues)
MDLSAAAALCLWLLSACRPRDGLEAAAVLRAAGAGPVRSPGGGGGGGGGGRTLAQAAGAA
AVPAAAVPRARAARRAAGSGFRNGSVVPHHFMMSLYRSLAGRAPAGAAAVSASGHGRADT
ITGFTDQATQDESAAETGQSFLFDVSSLNDADEVVGAELRVLRRGSPESGPGSWTSPPLL
LLSTCPGAARAPRLLYSRAAEPLVGQRWEAFDVADAMRRHRREPRPPRAFCLLLRAVAGP
VPSPLALRRLGFGWPGGGGSAAEERAVLVVSSRTQRKESLFREIRAQARALGAALASEPL
PDPGTGTASPRAVIGGRRRRRTALAGTRTAQGSGGGAGRGHGRRGRSRCSRKPLHVDFKE
LGWDDWIIAPLDYEAYHCEGLCDFPLRSHLEPTNHAIIQTLLNSMAPDAAPASCCVPARL
SPISILYIDAANNVVYKQYEDMVVEACGCR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z4P5	1.000	1.000	5.198E-83	450	1.000	1.000	Q7Z4P5.pdb.gz	GDF7_HUMAN Growth/differentiation factor 7 OS=Homo sapiens OX=9606 GN=GDF7 PE=2 SV=2
2	AFDB:P43029	0.759	0.742	8.955E-64	461	0.827	0.807	P43029.pdb.gz	GDF7_MOUSE Growth/differentiation factor 7 OS=Mus musculus OX=10090 GN=Gdf7 PE=2 SV=2
3	AFDB:Q6KF10	0.637	0.630	1.148E-40	455	0.456	0.451	Q6KF10.pdb.gz	GDF6_HUMAN Growth/differentiation factor 6 OS=Homo sapiens OX=9606 GN=GDF6 PE=1 SV=1
4	AFDB:P43028	0.633	0.627	2.815E-40	454	0.456	0.452	P43028.pdb.gz	GDF6_MOUSE Growth/differentiation factor 6 OS=Mus musculus OX=10090 GN=Gdf6 PE=2 SV=2
5	AFDB:P85857	0.628	0.697	2.488E-37	404	0.402	0.448	P85857.pdb.gz	GDF6A_DANRE Growth/differentiation factor 6-A OS=Danio rerio OX=7955 GN=gdf6a PE=1 SV=1
6	AFDB:P43026	0.624	0.563	8.929E-34	501	0.371	0.333	P43026.pdb.gz	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
7	AFDB:F1NUT2	0.563	0.546	4.962E-27	465	0.267	0.258	F1NUT2.pdb.gz
8	AFDB:P34820	0.567	0.630	7.771E-27	402	0.267	0.299	P34820.pdb.gz	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
9	AFDB:P34821	0.569	0.637	2.385E-26	399	0.233	0.263	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
10	AFDB:A8K571	0.552	0.575	8.660E-26	431	0.224	0.234	A8K571.pdb.gz	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
11	PDB:5hlyA	0.259	0.365	3.781E-13	299	0.164	0.247	5hlyA.pdb.gz
12	PDB:5ntuA	0.235	0.323	2.033E-12	308	0.140	0.205	5ntuA.pdb.gz
13	PDB:5vqfB	0.274	0.370	3.766E-12	320	0.167	0.234	5vqfB.pdb.gz
14	PDB:3rjrC	0.256	0.324	7.806E-12	343	0.173	0.227	3rjrC.pdb.gz
15	PDB:5nxsA	0.246	0.360	9.769E-12	290	0.153	0.238	5nxsA.pdb.gz
16	PDB:5ffoG	0.267	0.381	1.029E-10	297	0.178	0.269	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
17	PDB:7y1rB	0.244	0.339	1.612E-10	308	0.164	0.240	7y1rB.pdb.gz
18	PDB:6umxA	0.220	0.329	2.986E-10	279	0.136	0.219	6umxA.pdb.gz
19	PDB:5nxsB	0.194	0.311	2.368E-8	251	0.136	0.243	5nxsB.pdb.gz
20	PDB:6q2sA	0.144	0.522	3.453E-4	98	0.047	0.214	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P43029	0.0	516	461	0.760	0.742	GDF7_MOUSE Growth/differentiation factor 7 OS=Mus musculus OX=10090 GN=Gdf7 PE=2 SV=2
2	Q7Z4P5	0.0	884	450	1.000	1.000	GDF7_HUMAN Growth/differentiation factor 7 OS=Homo sapiens OX=9606 GN=GDF7 PE=2 SV=2
3	P43028	3.13e-106	324	454	0.440	0.436	GDF6_MOUSE Growth/differentiation factor 6 OS=Mus musculus OX=10090 GN=Gdf6 PE=2 SV=2
4	Q6KF10	1.88e-102	315	455	0.429	0.424	GDF6_HUMAN Growth/differentiation factor 6 OS=Homo sapiens OX=9606 GN=GDF6 PE=1 SV=1
5	P85857	4.48e-101	309	404	0.387	0.431	GDF6A_DANRE Growth/differentiation factor 6-A OS=Danio rerio OX=7955 GN=gdf6a PE=1 SV=1
6	P43026	7.67e-92	289	501	0.373	0.335	GDF5_HUMAN Growth/differentiation factor 5 OS=Homo sapiens OX=9606 GN=GDF5 PE=1 SV=4
7	P43027	1.42e-91	288	495	0.369	0.335	GDF5_MOUSE Growth/differentiation factor 5 OS=Mus musculus OX=10090 GN=Gdf5 PE=1 SV=2
8	M0RAY4	2.35e-91	287	495	0.371	0.337	M0RAY4_RAT Growth differentiation factor 5 OS=Rattus norvegicus OX=10116 GN=Gdf5 PE=3 SV=1
9	O57574	1.55e-46	167	400	0.284	0.320	O57574_DANRE Bone morphogenetic protein 4 OS=Danio rerio OX=7955 GN=zBMP-4 PE=2 SV=1
10	P21274	6.07e-46	166	394	0.267	0.305	BMP2_MOUSE Bone morphogenetic protein 2 OS=Mus musculus OX=10090 GN=Bmp2 PE=1 SV=3
11	C8C060	2.22e-45	164	396	0.262	0.298	C8C060_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=3 SV=1
12	P12643	2.22e-45	164	396	0.262	0.298	BMP2_HUMAN Bone morphogenetic protein 2 OS=Homo sapiens OX=9606 GN=BMP2 PE=1 SV=1
13	P49001	6.70e-45	162	393	0.262	0.300	BMP2_RAT Bone morphogenetic protein 2 OS=Rattus norvegicus OX=10116 GN=Bmp2 PE=2 SV=1
14	P12644	1.29e-44	162	408	0.262	0.289	BMP4_HUMAN Bone morphogenetic protein 4 OS=Homo sapiens OX=9606 GN=BMP4 PE=1 SV=1
15	O93369	2.97e-44	161	411	0.280	0.307	O93369_DANRE Bone morphogenetic protein 2 OS=Danio rerio OX=7955 GN=BMP2b PE=2 SV=1
16	O13109	7.49e-43	157	386	0.244	0.285	O13109_DANRE BMP2 OS=Danio rerio OX=7955 GN=BMP2 PE=2 SV=1
17	P21275	7.93e-43	157	408	0.247	0.272	BMP4_MOUSE Bone morphogenetic protein 4 OS=Mus musculus OX=10090 GN=Bmp4 PE=1 SV=2
18	Q90751	1.89e-42	155	353	0.247	0.314	BMP2_CHICK Bone morphogenetic protein 2 (Fragment) OS=Gallus gallus OX=9031 GN=BMP2 PE=2 SV=1
19	A5HMF9	2.22e-42	156	404	0.262	0.292	A5HMF9_ANAPL Bone morphogenetic protein 4 OS=Anas platyrhynchos OX=8839 GN=BMP4 PE=3 SV=1
20	Q06826	2.69e-42	156	408	0.244	0.270	BMP4_RAT Bone morphogenetic protein 4 OS=Rattus norvegicus OX=10116 GN=Bmp4 PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	7.4e-05	34.1	TGF-beta propeptide
2	PF00019 TGF_beta	1.7e-30	117.3	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000272224

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000363708	0.914	Bone morphogenetic protein receptor type-2
2	9606.ENSP00000401907	0.899	Bone morphogenetic protein receptor type-1B
3	9606.ENSP00000340361	0.890	Activin receptor type-2B
4	9606.ENSP00000379204	0.890	Bone morphogenetic protein 7
5	9606.ENSP00000361107	0.886	Bone morphogenetic protein receptor type-1A
6	9606.ENSP00000241416	0.875	Activin receptor type-2A
7	9606.ENSP00000204604	0.785	Chordin
8	9606.ENSP00000362122	0.768	Tenomodulin
9	9606.ENSP00000328181	0.745	Noggin
10	9606.ENSP00000417898	0.720	Glycodelin
11	9606.ENSP00000318650	0.696	Gremlin-2
12	9606.ENSP00000478319	0.691	Gremlin-1
13	9606.ENSP00000257863	0.672	Anti-Muellerian hormone type-2 receptor
14	9606.ENSP00000289749	0.636	Neuroblastoma suppressor of tumorigenicity 1
15	9606.ENSP00000476384	0.560	Basic helix-loop-helix transcription factor scleraxis
16	9606.ENSP00000340226	0.521	LIM homeobox transcription factor 1-alpha
17	9606.ENSP00000305193	0.520	HCLS1-binding protein 3
18	9606.ENSP00000052754	0.516	Decorin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.625	identical protein binding
GO:0005102	0.619	signaling receptor binding
GO:0098772	0.517	molecular function regulator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.991	multicellular organismal process
GO:0048856	0.991	anatomical structure development
GO:0007166	0.986	cell surface receptor signaling pathway
GO:0048522	0.982	positive regulation of cellular process
GO:0007275	0.981	multicellular organism development
GO:0007178	0.980	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0070848	0.962	response to growth factor
GO:0071363	0.943	cellular response to growth factor stimulus
GO:0071772	0.939	response to BMP
GO:0010468	0.928	regulation of gene expression
GO:0030509	0.926	BMP signaling pathway
GO:0009966	0.925	regulation of signal transduction
GO:0031323	0.918	regulation of cellular metabolic process
GO:0010647	0.882	positive regulation of cell communication
GO:0023056	0.881	positive regulation of signaling
GO:0048584	0.872	positive regulation of response to stimulus
GO:0009893	0.865	positive regulation of metabolic process
GO:0010604	0.864	positive regulation of macromolecule metabolic process
GO:0071704	0.846	organic substance metabolic process
GO:0044238	0.846	primary metabolic process
GO:0060393	0.841	regulation of pathway-restricted SMAD protein phosphorylation
GO:0044237	0.821	cellular metabolic process
GO:0050793	0.818	regulation of developmental process
GO:0051173	0.812	positive regulation of nitrogen compound metabolic process
GO:0048731	0.801	system development
GO:0009967	0.772	positive regulation of signal transduction
GO:0090092	0.764	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010556	0.759	regulation of macromolecule biosynthetic process
GO:0031326	0.759	regulation of cellular biosynthetic process
GO:0019219	0.756	regulation of nucleobase-containing compound metabolic process
GO:0006807	0.751	nitrogen compound metabolic process
GO:0006355	0.748	regulation of DNA-templated transcription
GO:0031325	0.747	positive regulation of cellular metabolic process
GO:0032924	0.727	activin receptor signaling pathway
GO:1901564	0.676	organonitrogen compound metabolic process
GO:0048513	0.661	animal organ development
GO:0090100	0.598	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0010557	0.592	positive regulation of macromolecule biosynthetic process
GO:0031328	0.591	positive regulation of cellular biosynthetic process
GO:0045935	0.586	positive regulation of nucleobase-containing compound metabolic process
GO:0043170	0.560	macromolecule metabolic process
GO:0051239	0.500	regulation of multicellular organismal process
GO:0048519	0.497	negative regulation of biological process
GO:0045893	0.495	positive regulation of DNA-templated transcription
GO:0045595	0.479	regulation of cell differentiation
GO:0045597	0.454	positive regulation of cell differentiation
GO:0030154	0.447	cell differentiation
GO:0006468	0.435	protein phosphorylation
GO:0009653	0.430	anatomical structure morphogenesis
GO:0048523	0.407	negative regulation of cellular process
GO:0007399	0.405	nervous system development
GO:0051240	0.395	positive regulation of multicellular organismal process
GO:0051247	0.365	positive regulation of protein metabolic process
GO:0006357	0.364	regulation of transcription by RNA polymerase II
GO:2000026	0.346	regulation of multicellular organismal development
GO:0001934	0.336	positive regulation of protein phosphorylation
GO:0045944	0.330	positive regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.401	cell periphery

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]