StarFunc result for job id Q7Z4S6

User Input

>input (1674 residues)
MLGAPDESSVRVAVRIRPQLAKEKIEGCHICTSVTPGEPQVFLGKDKAFTFDYVFDIDSQ
QEQIYIQCIEKLIEGCFEGYNATVFAYGQTGAGKTYTMGTGFDVNIVEEELGIISRAVKH
LFKSIEEKKHIAIKNGLPAPDFKVNAQFLELYNEEVLDLFDTTRDIDAKSKKSNIRIHED
STGGIYTVGVTTRTVNTESEMMQCLKLGALSRTTASTQMNVQSSRSHAIFTIHVCQTRVC
PQIDADNATDNKIISESAQMNEFETLTAKFHFVDLAGSERLKRTGATGERAKEGISINCG
LLALGNVISALGDKSKRATHVPYRDSKLTRLLQDSLGGNSQTIMIACVSPSDRDFMETLN
TLKYANRARNIKNKVMVNQDRASQQINALRSEITRLQMELMEYKTGKRIIDEEGVESIND
MFHENAMLQTENNNLRVRIKAMQETVDALRSRITQLVSDQANHVLARAGEGNEEISNMIH
SYIKEIEDLRAKLLESEAVNENLRKNLTRATARAPYFSGSSTFSPTILSSDKETIEIIDL
AKKDLEKLKRKEKRKKKRLQKLEESNREERSVAGKEDNTDTDQEKKEEKGVSERENNELE
VEESQEVSDHEDEEEEEEEEEDDIDGGESSDESDSESDEKANYQADLANITCEIAIKQKL
IDELENSQKRLQTLKKQYEEKLMMLQHKIRDTQLERDQVLQNLGSVESYSEEKAKKVRSE
YEKKLQAMNKELQRLQAAQKEHARLLKNQSQYEKQLKKLQQDVMEMKKTKVRLMKQMKEE
QEKARLTESRRNREIAQLKKDQRKRDHQLRLLEAQKRNQEVVLRRKTEEVTALRRQVRPM
SDKVAGKVTRKLSSSDAPAQDTGSSAAAVETDASRTGAQQKMRIPVARVQALPTPATNGN
RKKYQRKGLTGRVFISKTARMKWQLLERRVTDIIMQKMTISNMEADMNRLLKQREELTKR
REKLSKRREKIVKENGEGDKNVANINEEMESLTANIDYINDSISDCQANIMQMEEAKEEG
ETLDVTAVINACTLTEARYLLDHFLSMGINKGLQAAQKEAQIKVLEGRLKQTEITSATQN
QLLFHMLKEKAELNPELDALLGHALQDLDSVPLENVEDSTDEDAPLNSPGSEGSTLSSDL
MKLCGEVKPKNKARRRTTTQMELLYADSSELASDTSTGDASLPGPLTPVAEGQEIGMNTE
TSGTSAREKELSPPPGLPSKIGSISRQSSLSEKKIPEPSPVTRRKAYEKAEKSKAKEQKH
SDSGTSEASLSPPSSPPSRPRNELNVFNRLTVSQGNTSVQQDKSDESDSSLSEVHRSSRR
GIINPFPASKGIRAFPLQCIHIAEGHTKAVLCVDSTDDLLFTGSKDRTCKVWNLVTGQEI
MSLGGHPNNVVSVKYCNYTSLVFTVSTSYIKVWDIRDSAKCIRTLTSSGQVTLGDACSAS
TSRTVAIPSGENQINQIALNPTGTFLYAASGNAVRMWDLKRFQSTGKLTGHLGPVMCLTV
DQISSGQDLIITGSKDHYIKMFDVTEGALGTVSPTHNFEPPHYDGIEALTIQGDNLFSGS
RDNGIKKWDLTQKDLLQQVPNAHKDWVCALGVVPDHPVLLSGCRGGILKVWNMDTFMPVG
EMKGHDSPINAICVNSTHIFTAADDRTVRIWKARNLQDGQISDTGDLGEDIASN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z4S6	1.000	1.000	0.000	1674	1.000	1.000	Q7Z4S6.pdb.gz	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
2	AFDB:Q9QXL1	0.292	0.292	0.000	1668	0.594	0.596	Q9QXL1.pdb.gz	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
3	AFDB:Q6S000	0.187	0.208	6.553E-30	1499	0.148	0.165	Q6S000.pdb.gz	KIF12_DICDI Kinesin-related protein 12 OS=Dictyostelium discoideum OX=44689 GN=kif12 PE=3 SV=1
4	PDB:7wrgA	0.188	0.378	3.622E-27	812	0.084	0.172	7wrgA.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
5	PDB:7wrgB	0.182	0.380	7.570E-25	783	0.085	0.181	7wrgB.pdb.gz	The architecture of kinesin-3 KLP-6 reveals a multilevel-lockdown mechanism for autoinhibition.
6	PDB:5mzhB	0.159	0.582	2.784E-22	415	0.051	0.205	5mzhB.pdb.gz
7	PDB:4h1gA	0.161	0.389	4.238E-21	670	0.060	0.151	4h1gA.pdb.gz	Crystal structure of the Candida albicans Kar3 kinesin motor domain fused to maltose-binding protein.
8	AFDB:Q95RJ9	0.158	0.344	5.499E-21	700	0.065	0.154	Q95RJ9.pdb.gz	EBI_DROME F-box-like/WD repeat-containing protein ebi OS=Drosophila melanogaster OX=7227 GN=ebi PE=1 SV=2
9	PDB:1vyhC	0.163	0.824	1.195E-19	310	0.044	0.235	1vyhC.pdb.gz
10	PDB:7jvrB	0.162	0.748	2.330E-19	342	0.038	0.184	7jvrB.pdb.gz	Structural insights into the human D1 and D2 dopamine receptor signaling complexes.
11	PDB:5nnzA	0.157	0.681	3.171E-19	335	0.045	0.227	5nnzA.pdb.gz
12	AFDB:O48847	0.161	0.334	5.053E-19	787	0.062	0.131	O48847.pdb.gz	LUH_ARATH Transcriptional corepressor LEUNIG_HOMOLOG OS=Arabidopsis thaliana OX=3702 GN=LUH PE=1 SV=1
13	PDB:2h9lA	0.160	0.783	5.300E-19	321	0.045	0.237	2h9lA.pdb.gz
14	PDB:7qdrC	0.159	0.817	6.183E-19	305	0.041	0.223	7qdrC.pdb.gz
15	PDB:5yzgs	0.161	0.685	7.593E-19	374	0.038	0.168	5yzgs.pdb.gz	Structure of a human catalytic step I spliceosome
16	AFDB:Q7TNC6	0.179	0.144	1.244E-15	2112	0.112	0.089	Q7TNC6.pdb.gz	KI26B_MOUSE Kinesin-like protein KIF26B OS=Mus musculus OX=10090 GN=Kif26b PE=1 SV=3
17	AFDB:Q9ULI4	0.177	0.159	1.876E-15	1882	0.066	0.058	Q9ULI4.pdb.gz	KI26A_HUMAN Kinesin-like protein KIF26A OS=Homo sapiens OX=9606 GN=KIF26A PE=1 SV=3
18	AFDB:Q52KG5	0.179	0.160	9.706E-15	1881	0.060	0.053	Q52KG5.pdb.gz	KI26A_MOUSE Kinesin-like protein KIF26A OS=Mus musculus OX=10090 GN=Kif26a PE=1 SV=2
19	AFDB:Q389F7	0.156	0.233	4.815E-13	1105	0.035	0.052	Q389F7.pdb.gz	Q389F7_TRYB2 Small ribosomal subunit protein RACK1 OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.26.0030 PE=4 SV=1
20	AFDB:O14306	0.157	0.217	5.336E-13	1191	0.059	0.082	O14306.pdb.gz	YE8A_SCHPO Probable inositol polyphosphate 5-phosphatase C9G1.10c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC9G1.10c PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A1B0GV47	0.0	3413	1653	0.987	0.999	A0A1B0GV47_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
2	H0YHT2	0.0	2000	975	0.581	0.998	H0YHT2_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
3	H0YI78	0.0	1259	655	0.370	0.945	H0YI78_HUMAN Kinesin family member 21A (Fragment) OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=1
4	O75037	0.0	1921	1637	0.585	0.598	KI21B_HUMAN Kinesin-like protein KIF21B OS=Homo sapiens OX=9606 GN=KIF21B PE=1 SV=2
5	Q7Z4S6	0.0	3471	1674	1.000	1.000	KI21A_HUMAN Kinesin-like protein KIF21A OS=Homo sapiens OX=9606 GN=KIF21A PE=1 SV=2
6	Q9QXL1	0.0	1915	1668	0.590	0.592	KI21B_MOUSE Kinesin-like protein KIF21B OS=Mus musculus OX=10090 GN=Kif21b PE=1 SV=2
7	A0A068FIK2	9.55e-112	383	1033	0.126	0.204	KN4A_GOSHI Kinesin-like protein KIN-4A OS=Gossypium hirsutum OX=3635 GN=KIN4A PE=2 SV=1
8	Q8GS71	1.39e-107	371	1035	0.124	0.200	KN4A_ARATH Kinesin-like protein KIN-4A OS=Arabidopsis thaliana OX=3702 GN=KIN4A PE=1 SV=1
9	Q6YUL8	1.19e-106	368	1035	0.127	0.206	KN4A_ORYSJ Kinesin-like protein KIN-4A OS=Oryza sativa subsp. japonica OX=39947 GN=KIN4A PE=1 SV=1
10	F4K0J3	1.58e-106	374	1300	0.131	0.168	KN4C_ARATH Kinesin-like protein KIN-4C OS=Arabidopsis thaliana OX=3702 GN=KIN4C PE=2 SV=2
11	Q86VH2	1.66e-106	375	1401	0.112	0.134	KIF27_HUMAN Kinesin-like protein KIF27 OS=Homo sapiens OX=9606 GN=KIF27 PE=1 SV=1
12	O95239	3.34e-106	371	1232	0.115	0.156	KIF4A_HUMAN Chromosome-associated kinesin KIF4A OS=Homo sapiens OX=9606 GN=KIF4A PE=1 SV=3
13	P33174	4.54e-106	371	1231	0.114	0.155	KIF4_MOUSE Chromosome-associated kinesin KIF4 OS=Mus musculus OX=10090 GN=Kif4 PE=1 SV=3
14	Q2VIQ3	1.67e-105	369	1234	0.128	0.173	KIF4B_HUMAN Chromosome-associated kinesin KIF4B OS=Homo sapiens OX=9606 GN=KIF4B PE=2 SV=2
15	Q7M6Z4	5.60e-105	370	1394	0.109	0.131	KIF27_MOUSE Kinesin-like protein KIF27 OS=Mus musculus OX=10090 GN=Kif27 PE=1 SV=1
16	Q2M1P5	1.75e-96	344	1343	0.105	0.130	KIF7_HUMAN Kinesin-like protein KIF7 OS=Homo sapiens OX=9606 GN=KIF7 PE=1 SV=2
17	B7ZNG0	3.28e-95	340	1348	0.105	0.130	KIF7_MOUSE Kinesin-like protein KIF7 OS=Mus musculus OX=10090 GN=Kif7 PE=1 SV=1
18	Q58G59	2.39e-94	338	1363	0.108	0.133	KIF7_DANRE Kinesin-like protein kif7 OS=Danio rerio OX=7955 GN=kif7 PE=1 SV=1
19	Q9XZ29	1.20e-86	312	1212	0.103	0.142	Q9XZ29_DROME EG:BACR25B3.9 protein OS=Drosophila melanogaster OX=7227 GN=Klp3A PE=1 SV=1
20	P46873	4.65e-82	288	699	0.099	0.237	OSM3_CAEEL Osmotic avoidance abnormal protein 3 OS=Caenorhabditis elegans OX=6239 GN=osm-3 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00225 Kinesin	2.5e-104	360.4	Kinesin motor domain
2	PF16796 Microtub_bd	6.9e-19	79.8	Microtubule binding
3	PF20426 NBCH_WD40	0.039	24.4	Neurobeachin beta propeller domain
4	PF00400 WD40	6e-27	104.6	WD domain, G-beta repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000354878

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000477725	0.998	KN motif and ankyrin repeat domain-containing protein 1
2	9606.ENSP00000468002	0.956	KN motif and ankyrin repeat domain-containing protein 2
3	9606.ENSP00000298231	0.828	Paired mesoderm homeobox protein 2A
4	9606.ENSP00000314724	0.817	Liprin-beta-1
5	9606.ENSP00000320295	0.808	Tubulin beta-3 chain
6	9606.ENSP00000451560	0.804	Uncharacterized protein
7	9606.ENSP00000386741	0.781	N-chimaerin
8	9606.ENSP00000260731	0.773	Kinesin-like protein KIF11
9	9606.ENSP00000354560	0.773	Kinesin-associated protein 3
10	9606.ENSP00000296755	0.740	Microtubule-associated protein 1B
11	9606.ENSP00000344801	0.730	Sodium/potassium/calcium exchanger 2
12	9606.ENSP00000404190	0.698	Rac GTPase-activating protein 1
13	9606.ENSP00000408979	0.678	Kinesin heavy chain isoform 5A
14	9606.ENSP00000262215	0.667	Brefeldin A-inhibited guanine nucleotide-exchange protein 1
15	9606.ENSP00000265148	0.659	Centromere-associated protein E
16	9606.ENSP00000307078	0.655	Kinesin-1 heavy chain
17	9606.ENSP00000359664	0.654	Di-N-acetylchitobiase
18	9606.ENSP00000260363	0.652	Kinesin-like protein KIF23
19	9606.ENSP00000361298	0.641	Kinesin-like protein KIF2C
20	9606.ENSP00000259818	0.637	Tubulin beta-2B chain

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019904	0.998	protein domain specific binding
GO:0003774	0.833	cytoskeletal motor activity
GO:0071532	0.541	ankyrin repeat binding
GO:0003777	0.458	microtubule motor activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.992	cellular process
GO:0071840	0.965	cellular component organization or biogenesis
GO:0016043	0.951	cellular component organization
GO:0032501	0.864	multicellular organismal process
GO:0065007	0.837	biological regulation
GO:0050794	0.834	regulation of cellular process
GO:0007017	0.752	microtubule-based process
GO:0006996	0.549	organelle organization
GO:0051179	0.544	localization
GO:0051234	0.528	establishment of localization
GO:0051641	0.515	cellular localization
GO:0007010	0.433	cytoskeleton organization
GO:0000226	0.360	microtubule cytoskeleton organization
GO:0032502	0.353	developmental process
GO:0048518	0.335	positive regulation of biological process
GO:0007049	0.317	cell cycle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005886	0.998	plasma membrane
GO:0043232	0.961	intracellular non-membrane-bounded organelle
GO:0005856	0.878	cytoskeleton
GO:0015630	0.735	microtubule cytoskeleton
GO:0043227	0.631	membrane-bounded organelle
GO:0043231	0.571	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]