StarFunc result for job id Q7Z4V5

User Input

>input (671 residues)
MPHAFKPGDLVFAKMKGYPHWPARIDDIADGAVKPPPNKYPIFFFGTHETAFLGPKDLFP
YDKCKDKYGKPNKRKGFNEGLWEIQNNPHASYSAPPPVSSSDSEAPEANPADGSDADEDD
EDRGVMAVTAVTATAASDRMESDSDSDKSSDNSGLKRKTPALKMSVSKRARKASSDLDQA
SVSPSEEENSESSSESEKTSDQDFTPEKKAAVRAPRRGPLGGRKKKKAPSASDSDSKADS
DGAKPEPVAMARSASSSSSSSSSSDSDVSVKKPPRGRKPAEKPLPKPRGRKPKPERPPSS
SSSDSDSDEVDRISEWKRRDEARRRELEARRRREQEEELRRLREQEKEEKERRRERADRG
EAERGSGGSSGDELREDDEPVKKRGRKGRGRGPPSSSDSEPEAELEREAKKSAKKPQSSS
TEPARKPGQKEKRVRPEEKQQAKPVKVERTRKRSEGFSMDRKVEKKKEPSVEEKLQKLHS
EIKFALKVDSPDVKRCLNALEELGTLQVTSQILQKNTDVVATLKKIRRYKANKDVMEKAA
EVYTRLKSRVLGPKIEAVQKVNKAGMEKEKAEEKLAGEELAGEEAPQEKAEDKPSTDLSA
PVNGEATSQKGESAEDKEHEEGRDSEEGPRCGSSEDLHDSVREGPDLDRPGSDRQERERA
RGDSEALDEES

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z4V5	0.999	0.999	1.950E-87	671	1.000	1.000	Q7Z4V5.pdb.gz	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
2	AFDB:Q3UMU9	0.197	0.197	2.073E-71	669	0.817	0.819	Q3UMU9.pdb.gz	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
3	AFDB:Q5XXA9	0.159	0.183	4.060E-29	579	0.282	0.326	Q5XXA9.pdb.gz	PSIP1_CHICK Lens epithelium-derived growth factor OS=Gallus gallus OX=9031 GN=PSIP1 PE=2 SV=1
4	AFDB:O75475	0.158	0.189	1.812E-26	530	0.270	0.342	O75475.pdb.gz	PSIP1_HUMAN PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1
5	AFDB:A0A024R216	0.144	0.466	2.958E-16	203	0.146	0.483	A0A024R216.pdb.gz
6	AFDB:Q5FVD1	0.139	0.447	1.749E-15	201	0.145	0.483	Q5FVD1.pdb.gz	Q5FVD1_DANRE Hepatoma-derived growth factor-related protein 3 OS=Danio rerio OX=7955 GN=zgc:92612 PE=1 SV=1
7	AFDB:A0A384NPW1	0.139	0.370	2.830E-14	240	0.139	0.388	A0A384NPW1.pdb.gz	A0A384NPW1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
8	AFDB:P51859	0.135	0.371	4.824E-14	237	0.136	0.384	P51859.pdb.gz	HDGF_MOUSE Hepatoma-derived growth factor OS=Mus musculus OX=10090 GN=Hdgf PE=1 SV=2
9	PDB:6s01K	0.123	0.854	5.529E-10	86	0.100	0.779	6s01K.pdb.gz	Structure of H3K36-methylated nucleosome-PWWP complex reveals multivalent cross-gyre binding.
10	AFDB:Q9LEY4	0.116	0.056	2.517E-6	1445	0.145	0.067	Q9LEY4.pdb.gz	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
11	AFDB:Q9XER9	0.117	0.058	1.488E-5	1392	0.149	0.072	Q9XER9.pdb.gz	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
12	PDB:7e29A	0.100	0.131	5.178E-3	496	0.034	0.046	7e29A.pdb.gz	H3K36 methylation and DNA-binding both promote Ioc4 recruitment and Isw1b remodeler function.
13	PDB:3p8bB	0.071	0.296	9.433E-2	147	0.012	0.054	3p8bB.pdb.gz	RNA polymerase and transcription elongation factor Spt4/5 complex structure.
14	PDB:7okyZ	0.043	0.072	9.433E-2	374	0.024	0.043	7okyZ.pdb.gz	Allosteric transcription stimulation by RNA polymerase II super elongation complex.
15	PDB:7nkxZ	0.071	0.282	1.195E-1	156	0.015	0.064	7nkxZ.pdb.gz	Structural basis of nucleosome transcription mediated by Chd1 and FACT.
16	PDB:6tedZ	0.064	0.084	1.428E-1	510	0.013	0.018	6tedZ.pdb.gz	Structure of complete Pol II-DSIF-PAF-SPT6 transcription complex reveals RTF1 allosteric activation.
17	PDB:4v8mBa	0.073	0.300	2.037E-1	132	0.019	0.098	4v8mBa.pdb.gz	High-Resolution Cryo-Electron Microscopy Structure of the Trypanosoma Brucei Ribosome.
18	PDB:4zn3A	0.073	0.309	2.162E-1	147	0.007	0.034	4zn3A.pdb.gz	Structural and biochemical insights into the DNA-binding mode of MjSpt4p:Spt5 complex at the exit tunnel of RNAPII
19	PDB:7ajtUO	0.097	0.126	2.582E-1	493	0.027	0.037	7ajtUO.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.
20	PDB:7mq8LJ	0.076	0.098	3.084E-1	469	0.024	0.034	7mq8LJ.pdb.gz	Nucleolar maturation of the human small subunit processome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q3UMU9	0.0	781	669	0.799	0.801	HDGR2_MOUSE Hepatoma-derived growth factor-related protein 2 OS=Mus musculus OX=10090 GN=Hdgfl2 PE=1 SV=1
2	Q7Z4V5	0.0	1319	671	1.000	1.000	HDGR2_HUMAN Hepatoma-derived growth factor-related protein 2 OS=Homo sapiens OX=9606 GN=HDGFL2 PE=1 SV=1
3	Q925G1	0.0	780	669	0.781	0.783	HDGR2_RAT Hepatoma-derived growth factor-related protein 2 OS=Rattus norvegicus OX=10116 GN=Hdgfl2 PE=1 SV=2
4	Q9Y3E1	9.35e-53	182	203	0.125	0.414	HDGR3_HUMAN Hepatoma-derived growth factor-related protein 3 OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1
5	Q9JMG7	1.47e-52	182	202	0.122	0.406	HDGR3_MOUSE Hepatoma-derived growth factor-related protein 3 OS=Mus musculus OX=10090 GN=Hdgfl3 PE=1 SV=2
6	Q5XXA9	2.73e-51	189	579	0.125	0.145	PSIP1_CHICK Lens epithelium-derived growth factor OS=Gallus gallus OX=9031 GN=PSIP1 PE=2 SV=1
7	Q5FVD1	5.62e-51	177	201	0.119	0.398	Q5FVD1_DANRE Hepatoma-derived growth factor-related protein 3 OS=Danio rerio OX=7955 GN=zgc:92612 PE=1 SV=1
8	O75475	6.78e-51	187	530	0.116	0.147	PSIP1_HUMAN PC4 and SFRS1-interacting protein OS=Homo sapiens OX=9606 GN=PSIP1 PE=1 SV=1
9	Q812D1	1.04e-50	186	528	0.115	0.146	PSIP1_RAT PC4 and SFRS1-interacting protein OS=Rattus norvegicus OX=10116 GN=Psip1 PE=1 SV=1
10	Q99JF8	2.14e-50	185	528	0.109	0.138	PSIP1_MOUSE PC4 and SFRS1-interacting protein OS=Mus musculus OX=10090 GN=Psip1 PE=1 SV=1
11	P51859	6.14e-44	159	237	0.110	0.312	HDGF_MOUSE Hepatoma-derived growth factor OS=Mus musculus OX=10090 GN=Hdgf PE=1 SV=2
12	Q8VHK7	1.29e-43	159	237	0.097	0.274	HDGF_RAT Hepatoma-derived growth factor OS=Rattus norvegicus OX=10116 GN=Hdgf PE=1 SV=2
13	A0A384NPW1	3.78e-43	157	240	0.097	0.271	A0A384NPW1_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=2 SV=1
14	P51858	3.78e-43	157	240	0.097	0.271	HDGF_HUMAN Hepatoma-derived growth factor OS=Homo sapiens OX=9606 GN=HDGF PE=1 SV=1
15	H3BPM9	3.39e-10	60.8	141	0.045	0.213	H3BPM9_HUMAN HDGF like 3 (Fragment) OS=Homo sapiens OX=9606 GN=HDGFL3 PE=1 SV=1
16	Q9XER9	6.03e-09	62.0	1392	0.040	0.019	HUA2_ARATH ENHANCER OF AG-4 protein 2 OS=Arabidopsis thaliana OX=3702 GN=HUA2 PE=2 SV=1
17	Q9LEY4	5.40e-08	58.9	1445	0.037	0.017	HUAL1_ARATH Protein HUA2-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=HULK1 PE=2 SV=1
18	F4IN78	8.32e-07	55.1	1366	0.034	0.017	HUAL2_ARATH Protein HUA2-LIKE 2 OS=Arabidopsis thaliana OX=3702 GN=HULK2 PE=2 SV=2
19	Q8T079	1.94e-04	47.0	602	0.040	0.045	GLYR1_DROME Cytokine-like nuclear factor N-PAC OS=Drosophila melanogaster OX=7227 GN=Ndf PE=1 SV=1
20	Q922P9	8.44e-04	45.1	546	0.040	0.049	GLYR1_MOUSE Cytokine-like nuclear factor N-PAC OS=Mus musculus OX=10090 GN=Glyr1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11467 LEDGF	3.6e-23	92.8	Lens epithelium-derived growth factor (LEDGF)
2	PF00855 PWWP	9.3e-10	50.2	PWWP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000483345

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000271715	0.717	Pogo transposable element with ZNF domain
2	9606.ENSP00000396160	0.717	Fibrosin-1-like protein
3	9606.ENSP00000373696	0.671	E3 ubiquitin-protein ligase TRIP12
4	9606.ENSP00000333277	0.660	Histone cluster 2 H3 family member d
5	9606.ENSP00000325002	0.656	Coatomer subunit gamma-1
6	9606.ENSP00000295321	0.645	Protein IWS1 homolog
7	9606.ENSP00000402346	0.610	Coatomer subunit gamma-2
8	9606.ENSP00000373340	0.595	Peregrin
9	9606.ENSP00000353025	0.569	Protein FAM3C
10	9606.ENSP00000267970	0.559	Tetraspanin-3
11	9606.ENSP00000374353	0.547	Hydroxyacylglutathione hydrolase-like protein
12	9606.ENSP00000377060	0.536	Chromobox protein homolog 1
13	9606.ENSP00000266070	0.519	Death-inducer obliterator 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0035064	0.984	methylated histone binding
GO:0061628	0.844	H3K27me3 modified histone binding
GO:0062072	0.843	H3K9me3 modified histone binding
GO:0097159	0.582	organic cyclic compound binding
GO:0003676	0.517	nucleic acid binding
GO:0003677	0.385	DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.985	biological regulation
GO:0009987	0.983	cellular process
GO:0050794	0.976	regulation of cellular process
GO:0042692	0.885	muscle cell differentiation
GO:0019219	0.885	regulation of nucleobase-containing compound metabolic process
GO:0060255	0.882	regulation of macromolecule metabolic process
GO:0048522	0.881	positive regulation of cellular process
GO:0048583	0.771	regulation of response to stimulus
GO:0009893	0.658	positive regulation of metabolic process
GO:0010604	0.648	positive regulation of macromolecule metabolic process
GO:0051052	0.428	regulation of DNA metabolic process
GO:0031325	0.413	positive regulation of cellular metabolic process
GO:0051173	0.375	positive regulation of nitrogen compound metabolic process
GO:0045935	0.352	positive regulation of nucleobase-containing compound metabolic process
GO:0080135	0.338	regulation of cellular response to stress
GO:2001020	0.309	regulation of response to DNA damage stimulus
GO:0000018	0.307	regulation of DNA recombination

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	1.000	nucleus
GO:0005737	0.931	cytoplasm
GO:0070013	0.519	intracellular organelle lumen
GO:0031981	0.514	nuclear lumen
GO:0005654	0.490	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]