StarFunc result for job id Q7Z569

User Input

>input (592 residues)
MSVSLVVIRLELAEHSPVPAGFGFSAAAGEMSDEEIKKTTLASAVACLEGKSPGEKVAII
HQHLGRREMTDVIIETMKSNPDELKTTVEERKSSEASPTAQRSKDHSKECINAAPDSPSK
QLPDQISFFSGNPSVEIVHGIMHLYKTNKMTSLKEDVRRSAMLCILTVPAAMTSHDLMKF
VAPFNEVIEQMKIIRDSTPNQYMVLIKFRAQADADSFYMTCNGRQFNSIEDDVCQLVYVE
RAEVLKSEDGASLPVMDLTELPKCTVCLERMDESVNGILTTLCNHSFHSQCLQRWDDTTC
PVCRYCQTPEPVEENKCFECGVQENLWICLICGHIGCGRYVSRHAYKHFEETQHTYAMQL
TNHRVWDYAGDNYVHRLVASKTDGKIVQYECEGDTCQEEKIDALQLEYSYLLTSQLESQR
IYWENKIVRIEKDTAEEINNMKTKFKETIEKCDNLEHKLNDLLKEKQSVERKCTQLNTKV
AKLTNELKEEQEMNKCLRANQVLLQNKLKEEERVLKETCDQKDLQITEIQEQLRDVMFYL
ETQQKINHLPAETRQEIQEGQINIAMASASSPASSGGSGKLPSRKGRSKRGK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z569	1.000	1.000	2.271E-101	592	1.000	1.000	Q7Z569.pdb.gz	BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens OX=9606 GN=BRAP PE=1 SV=2
2	AFDB:O80996	0.153	0.187	2.817E-27	479	0.275	0.340	O80996.pdb.gz	BRIZ2_ARATH BRAP2 RING ZnF UBP domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=BRIZ2 PE=1 SV=1
3	AFDB:P38748	0.163	0.165	8.883E-27	585	0.282	0.285	P38748.pdb.gz	ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ETP1 PE=1 SV=1
4	AFDB:Q581T5	0.165	0.190	4.815E-10	496	0.133	0.159	Q581T5.pdb.gz	Q581T5_TRYB2 UBP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.670 PE=4 SV=1
5	AFDB:Q38FD4	0.152	0.163	5.720E-10	551	0.152	0.163	Q38FD4.pdb.gz	Q38FD4_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2620 PE=4 SV=1
6	PDB:4msxA	0.100	0.148	1.059E-2	395	0.025	0.038	4msxA.pdb.gz	The crystal structure of S. cerevisiae Sad1, a catalytically inactive deubiquitinase that is broadly required for pre-mRNA splicing.
7	PDB:5me5A	0.108	0.315	1.122E-2	152	0.024	0.092	5me5A.pdb.gz
8	PDB:3lqvB	0.111	0.488	1.258E-2	115	0.020	0.104	3lqvB.pdb.gz	Branch Recognition by SF3b14
9	PDB:3jcrV	0.100	0.137	1.776E-2	431	0.024	0.032	3jcrV.pdb.gz
10	PDB:3pgwP	0.125	0.568	2.654E-2	113	0.024	0.124	3pgwP.pdb.gz
11	PDB:5oobB	0.122	0.437	2.811E-2	152	0.019	0.072	5oobB.pdb.gz	Structural basis for mutually exclusive co-transcriptional nuclear cap-binding complexes with either NELF-E or ARS2.
12	PDB:4wa6D	0.097	0.137	2.977E-2	415	0.025	0.036	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
13	PDB:3ihpB	0.097	0.084	3.746E-2	681	0.042	0.037	3ihpB.pdb.gz	Covalent Ubiquitin-Usp5 Complex
14	PDB:5wb5A	0.097	0.276	3.967E-2	167	0.022	0.078	5wb5A.pdb.gz
15	AFDB:Q9NWH9	0.119	0.071	4.875E-2	1034	0.115	0.066	Q9NWH9.pdb.gz	SLTM_HUMAN SAFB-like transcription modulator OS=Homo sapiens OX=9606 GN=SLTM PE=1 SV=2
16	PDB:6zmwo	0.116	0.742	5.287E-2	77	0.024	0.182	6zmwo.pdb.gz	Structure of a human 48Stranslational initiation complex.
17	AFDB:J3KQW6	0.133	0.248	1.934E-1	282	0.076	0.160	J3KQW6.pdb.gz	J3KQW6_HUMAN Tripartite motif containing 73 OS=Homo sapiens OX=9606 GN=TRIM73 PE=4 SV=1
18	AFDB:Q8LA96	0.116	0.212	3.853E-1	313	0.020	0.038	Q8LA96.pdb.gz	Q8LA96_ARATH Putative RRM-containing protein OS=Arabidopsis thaliana OX=3702 GN=BPL1 PE=1 SV=1
19	AFDB:Q8K2Y0	0.131	0.112	8.609E-1	722	0.091	0.075	Q8K2Y0.pdb.gz	OBI1_MOUSE ORC ubiquitin ligase 1 OS=Mus musculus OX=10090 GN=Obi1 PE=1 SV=2
20	AFDB:O17099	0.149	0.224	1.147	374	0.073	0.115	O17099.pdb.gz	O17099_CAEEL Major sperm protein OS=Caenorhabditis elegans OX=6239 GN=CELE_F42G2.5 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KNN7	0.0	1176	562	0.949	1.000	J3KNN7_HUMAN BRCA1 associated protein OS=Homo sapiens OX=9606 GN=BRAP PE=1 SV=1
2	Q7Z569	0.0	1236	592	1.000	1.000	BRAP_HUMAN BRCA1-associated protein OS=Homo sapiens OX=9606 GN=BRAP PE=1 SV=2
3	Q99MP8	0.0	1111	591	0.909	0.910	BRAP_MOUSE BRCA1-associated protein OS=Mus musculus OX=10090 GN=Brap PE=1 SV=1
4	O80996	5.82e-92	293	479	0.299	0.370	BRIZ2_ARATH BRAP2 RING ZnF UBP domain-containing protein 2 OS=Arabidopsis thaliana OX=3702 GN=BRIZ2 PE=1 SV=1
5	O13747	5.67e-87	282	547	0.279	0.302	EPT1_SCHPO RING finger protein ETP1 homolog OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPAC16E8.13 PE=3 SV=1
6	E5KGE0	8.22e-81	264	488	0.264	0.320	BRIZ1_ARATH BRAP2 RING ZnF UBP domain-containing protein 1 OS=Arabidopsis thaliana OX=3702 GN=BRIZ1 PE=1 SV=1
7	P38748	4.05e-70	239	585	0.287	0.291	ETP1_YEAST RING finger protein ETP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ETP1 PE=1 SV=1
8	Q38FD4	6.01e-20	95.9	551	0.101	0.109	Q38FD4_TRYB2 RING-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.160.2620 PE=4 SV=1
9	Q581T5	1.35e-19	94.4	496	0.142	0.169	Q581T5_TRYB2 UBP-type domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb04.2L9.670 PE=4 SV=1
10	Q70CQ1	1.29e-11	69.7	688	0.047	0.041	UBP49_HUMAN Ubiquitin carboxyl-terminal hydrolase 49 OS=Homo sapiens OX=9606 GN=USP49 PE=1 SV=1
11	Q9H0E7	5.08e-11	68.2	712	0.042	0.035	UBP44_HUMAN Ubiquitin carboxyl-terminal hydrolase 44 OS=Homo sapiens OX=9606 GN=USP44 PE=1 SV=2
12	Q54QE6	2.16e-10	65.5	512	0.042	0.049	SIR2A_DICDI NAD-dependent deacetylase sir2A OS=Dictyostelium discoideum OX=44689 GN=sir2A PE=2 SV=1
13	Q7ZUM8	3.93e-10	65.1	695	0.041	0.035	UBP44_DANRE Ubiquitin carboxyl-terminal hydrolase 44 OS=Danio rerio OX=7955 GN=usp44 PE=2 SV=1
14	F8W4B7	7.15e-10	64.7	1081	0.051	0.028	F8W4B7_DANRE Histone deacetylase 6 OS=Danio rerio OX=7955 GN=hdac6 PE=1 SV=1
15	A7YT55	8.14e-10	64.3	929	0.054	0.034	A7YT55_DANRE Hdac6 protein (Fragment) OS=Danio rerio OX=7955 GN=hdac6 PE=1 SV=1
16	Q8C2S0	3.57e-09	62.0	711	0.037	0.031	UBP44_MOUSE Ubiquitin carboxyl-terminal hydrolase 44 OS=Mus musculus OX=10090 GN=Usp44 PE=1 SV=3
17	Q8IR37	2.73e-08	59.3	1138	0.052	0.027	Q8IR37_DROME Histone deacetylase 6 isoform C OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
18	Q86NK9	2.95e-08	59.3	1128	0.052	0.027	Q86NK9_DROME Histone deacetylase 6 isoform A OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
19	Q8IR38	3.16e-08	59.3	1135	0.052	0.027	Q8IR38_DROME Histone deacetylase 6 isoform B OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1
20	M9PJN5	3.19e-08	59.3	1179	0.052	0.026	M9PJN5_DROME Histone deacetylase 6, isoform G OS=Drosophila melanogaster OX=7227 GN=HDAC6 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07576 BRAP2	5.2e-32	121.4	BRCA1-associated protein 2
2	PF14362 DUF4407	6.2e+02	11.1	Domain of unknown function (DUF4407)
3	PF02841 GBP_C	80	14.1	Guanylate-binding protein, C-terminal domain
4	PF14662 KASH_CCD	5.8e+02	11.7	Coiled-coil region of CCDC155 or KASH
5	PF00076 RRM_1	29	15.9	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
6	PF01496 V_ATPase_I	3.5e+02	10.5	V-type ATPase 116kDa subunit family
7	PF12861 zf-ANAPC11	6.2	18.3	Anaphase-promoting complex subunit 11 RING-H2 finger
8	PF17122 zf-C3H2C3	65	15.0	Zinc-finger
9	PF00097 zf-C3HC4	0.28	22.4	Zinc finger, C3HC4 type (RING finger)
10	PF13923 zf-C3HC4_2	0.0022	29.1	Zinc finger, C3HC4 type (RING finger)
11	PF13920 zf-C3HC4_3	39	15.5	Zinc finger, C3HC4 type (RING finger)
12	PF12678 zf-rbx1	0.041	25.5	RING-H2 zinc finger domain
13	PF17123 zf-RING_11	0.1	23.7	RING-like zinc finger
14	PF17120 zf-RING_16	5e+02	11.7	RING/Ubox like zinc-binding domain
15	PF13639 zf-RING_2	8.8e-05	34.1	Ring finger domain
16	PF14634 zf-RING_5	0.041	25.2	zinc-RING finger domain
17	PF13445 zf-RING_UBOX	0.087	24.2	RING-type zinc-finger
18	PF02148 zf-UBP	3.3e-17	73.9	Zn-finger in ubiquitin-hydrolases and other protein

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000403524

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000381958	0.988	Kinase suppressor of Ras 1
2	9606.ENSP00000441543	0.973	Polyubiquitin-C
3	9606.ENSP00000418960	0.962	Breast cancer type 1 susceptibility protein
4	9606.ENSP00000304697	0.958	Polyubiquitin-B
5	9606.ENSP00000251849	0.949	RAF proto-oncogene serine/threonine-protein kinase
6	9606.ENSP00000288602	0.934	Serine/threonine-protein kinase B-raf
7	9606.ENSP00000272317	0.931	Ubiquitin-40S ribosomal protein S27a
8	9606.ENSP00000290277	0.913	Serine/threonine-protein kinase A-Raf
9	9606.ENSP00000388107	0.903	Ubiquitin-60S ribosomal protein L40
10	9606.ENSP00000361930	0.902	14-3-3 protein beta/alpha
11	9606.ENSP00000407586	0.877	GTPase HRas
12	9606.ENSP00000256078	0.832	GTPase KRas
13	9606.ENSP00000358548	0.829	GTPase NRas
14	9606.ENSP00000389715	0.817	Kinase suppressor of Ras 2
15	9606.ENSP00000256196	0.812	Ras-related protein R-Ras2
16	9606.ENSP00000289104	0.807	Ras-related protein M-Ras
17	9606.ENSP00000246792	0.803	Ras-related protein R-Ras
18	9606.ENSP00000339637	0.780	BRCA1-associated ATM activator 1
19	9606.ENSP00000366843	0.732	Ataxin-2
20	9606.ENSP00000350719	0.727	Nesprin-2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0004842	0.999	ubiquitin-protein transferase activity
GO:0042802	0.996	identical protein binding
GO:0008139	0.994	nuclear localization sequence binding
GO:0061630	0.981	ubiquitin protein ligase activity
GO:1901363	0.333	heterocyclic compound binding
GO:0097159	0.333	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.999	regulation of biological process
GO:0071704	0.987	organic substance metabolic process
GO:0035556	0.987	intracellular signal transduction
GO:0044238	0.985	primary metabolic process
GO:0023051	0.984	regulation of signaling
GO:0010646	0.974	regulation of cell communication
GO:0048583	0.950	regulation of response to stimulus
GO:0006807	0.945	nitrogen compound metabolic process
GO:0048523	0.920	negative regulation of cellular process
GO:0043170	0.916	macromolecule metabolic process
GO:0036211	0.905	protein modification process
GO:0009966	0.897	regulation of signal transduction
GO:0070647	0.891	protein modification by small protein conjugation or removal
GO:0000165	0.841	MAPK cascade
GO:0007264	0.817	small GTPase mediated signal transduction
GO:0032446	0.529	protein modification by small protein conjugation
GO:0016567	0.516	protein ubiquitination
GO:0048585	0.436	negative regulation of response to stimulus
GO:0048518	0.429	positive regulation of biological process
GO:0044237	0.419	cellular metabolic process
GO:0019222	0.407	regulation of metabolic process
GO:0007265	0.400	Ras protein signal transduction
GO:0009968	0.399	negative regulation of signal transduction
GO:0048522	0.380	positive regulation of cellular process
GO:0060255	0.353	regulation of macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm
GO:0012505	0.997	endomembrane system
GO:0032991	0.993	protein-containing complex
GO:0016020	0.992	membrane
GO:0031090	0.942	organelle membrane
GO:1902494	0.913	catalytic complex
GO:0000151	0.767	ubiquitin ligase complex
GO:0031967	0.731	organelle envelope
GO:0005635	0.534	nuclear envelope
GO:0031965	0.513	nuclear membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.999	Transferases.

[back to server]