StarFunc result for job id Q7Z570

User Input

>input (1209 residues)
MECYYIVISSTHLSNGHFRNIKGVFRGPLSKNGNKTLDYAEKENTIAKALEDLKANFYCE
LCDKQYYKHQEFDNHINSYDHAHKQRLKELKQREFARNVASKSRKDERKQEKALQRLHKL
AELRKETVCAPGSGPMFKSTTVTVRENCNEISQRVVVDSVNNQQDFKYTLIHSEENTKDA
TTVAEDPESANNYTAKNNQVGDQAQGIHRHKIGFSFAFPKKASVKLESSAAAFSEYSDDA
SVGKGFSRKSRFVPSACHLQQSSPTDVLLSSEEKTNSFHPPEAMCRDKETVQTQEIKEVS
SEKDALLLPSFCKFQLQLSSDADNCQNSVPLADQIPLESVVINEDIPVSGNSFELLGNKS
TVLDMSNDCISVQATTEENVKHNEASTTEVENKNGPETLAPSNTEEVNITIHKKTNFCKR
QCEPFVPVLNKHRSTVLQWPSEMLVYTTTKPSISYSCNPLCFDFKSTKVNNNLDKNKPDL
KDLCSQQKQEDICMGPLSDYKDVSTEGLTDYEIGSSKNKCSQVTPLLADDILSSSCDSGK
NENTGQRYKNISCKIRETEKYNFTKSQIKQDTLDEKYNKIRLKETHEYWFHKSRRKKKRK
KLCQHHHMEKTKESETRCKMEAENSYTENAGKYLLEPISEKQYLAAEQLLDSHQLLDKRP
KSESISLSDNEEMCKTWNTEYNTYDTISSKNHCKKNTILLNGQSNATMIHSGKHNLTYSR
TYCCWKTKMSSCSQDHRSLVLQNDMKHMSQNQAVKRGYNSVMNESERFYRKRRQHSHSYS
SDESLNRQNHLPEEFLRPPSTSVAPCKPKKKRRRKRGRFHPGFETLELKENTDYPVKDNS
SLNPLDRLISEDKKEKMKPQEVAKIERNSEQTNQLRNKLSFHPNNLLPSETNGETEHLEM
ETTSGELSDVSNDPTTSVCVASAPTKEAIDNTLLEHKERSENINLNEKQIPFQVPNIERN
FRQSQPKSYLCHYELAEALPQGKMNETPTEWLRYNSGILNTQPPLPFKEAHVSGHTFVTA
EQILAPLALPEQALLIPLENHDKFKNVPCEVYQHILQPNMLANKVKFTFPPAALPPPSTP
LQPLPLQQSLCSTSVTTIHHTVLQQHAAAAAAAAAAAAAGTFKVLQPHQQFLSQIPALTR
TSLPQLSVGPVGPRLCPGNQPTFVAPPQMPIIPASVLHPSHLAFPSLPHALFPSLLSPHP
TVIPLQPLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z570	0.999	0.999	0.000	1209	1.000	1.000	Q7Z570.pdb.gz	Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens OX=9606 GN=ZNF804A PE=2 SV=3
2	AFDB:F1M078	0.233	0.240	1.451E-101	1164	0.622	0.646	F1M078.pdb.gz	F1M078_RAT Zinc finger protein 804A OS=Rattus norvegicus OX=10116 GN=Zfp804a PE=4 SV=4
3	AFDB:A2A6A1	0.091	0.074	2.111E-26	1505	0.256	0.206	A2A6A1.pdb.gz	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
4	AFDB:Q9NZ56	0.048	0.037	6.796E-4	1722	0.116	0.081	Q9NZ56.pdb.gz	FMN2_HUMAN Formin-2 OS=Homo sapiens OX=9606 GN=FMN2 PE=1 SV=4
5	AFDB:Q9VMD0	0.035	0.028	1.089E-3	1659	0.104	0.076	Q9VMD0.pdb.gz	DAXX_DROME Daxx-like protein OS=Drosophila melanogaster OX=7227 GN=Daxx PE=1 SV=3
6	AFDB:Q5VUA4	0.064	0.041	1.632E-3	2279	0.147	0.078	Q5VUA4.pdb.gz	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
7	AFDB:Q9H7P9	0.042	0.039	1.746E-3	1386	0.127	0.110	Q9H7P9.pdb.gz	PKHG2_HUMAN Pleckstrin homology domain-containing family G member 2 OS=Homo sapiens OX=9606 GN=PLEKHG2 PE=1 SV=3
8	AFDB:D4A9T1	0.036	0.041	1.998E-3	987	0.126	0.154	D4A9T1.pdb.gz	D4A9T1_RAT Ring finger protein 111 OS=Rattus norvegicus OX=10116 GN=Rnf111 PE=3 SV=2
9	AFDB:O00512	0.039	0.037	6.720E-3	1426	0.120	0.102	O00512.pdb.gz	BCL9_HUMAN B-cell CLL/lymphoma 9 protein OS=Homo sapiens OX=9606 GN=BCL9 PE=1 SV=4
10	AFDB:Q56A10	0.043	0.038	8.799E-3	1511	0.132	0.105	Q56A10.pdb.gz	ZN608_MOUSE Zinc finger protein 608 OS=Mus musculus OX=10090 GN=Znf608 PE=1 SV=1
11	PDB:7mqaSS	0.027	0.087	6.694E-1	350	0.023	0.080	7mqaSS.pdb.gz	Nucleolar maturation of the human small subunit processome.
12	PDB:6qx91C	0.033	0.540	7.160E-1	50	0.008	0.200	6qx91C.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
13	PDB:1ho5A	0.022	0.041	2.756	525	0.003	0.008	1ho5A.pdb.gz	Mechanism of hydrolysis of phosphate esters by the dimetal center of 5'-nucleotidase based on crystal structures.
14	PDB:6t9iE	0.022	0.052	3.154	433	0.012	0.032	6t9iE.pdb.gz
15	PDB:1bo0A	0.030	0.189	3.374	76	0.012	0.197	1bo0A.pdb.gz
16	PDB:5gm6I	0.038	0.322	3.374	102	0.009	0.108	5gm6I.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
17	PDB:6g90U	0.032	0.194	3.609	196	0.004	0.026	6g90U.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
18	PDB:5nrlU	0.028	0.169	4.130	196	0.004	0.026	5nrlU.pdb.gz	Structure of a pre-catalytic spliceosome.
19	PDB:7pubIA	0.023	0.037	6.188	693	0.007	0.012	7pubIA.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
20	PDB:6bk8O	0.027	0.105	6.619	229	0.005	0.026	6bk8O.pdb.gz	Structure of the yeast spliceosomal postcatalytic P complex.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1M078	0.0	1486	1198	0.654	0.660	F1M078_RAT Zinc finger protein 804A OS=Rattus norvegicus OX=10116 GN=Zfp804a PE=4 SV=4
2	Q7Z570	0.0	2514	1209	1.000	1.000	Z804A_HUMAN Zinc finger protein 804A OS=Homo sapiens OX=9606 GN=ZNF804A PE=2 SV=3
3	A2A6A1	7.36e-57	218	1505	0.101	0.081	GPTC8_MOUSE G patch domain-containing protein 8 OS=Mus musculus OX=10090 GN=Gpatch8 PE=1 SV=1
4	Q9UKJ3	5.48e-56	216	1502	0.099	0.080	GPTC8_HUMAN G patch domain-containing protein 8 OS=Homo sapiens OX=9606 GN=GPATCH8 PE=1 SV=2
5	Q147M4	3.41e-12	71.2	301	0.027	0.110	Q147M4_ARATH At5g26610 OS=Arabidopsis thaliana OX=3702 GN=At5g26610 PE=1 SV=1
6	O94667	1.0	35.8	560	0.015	0.032	RTF1_SCHPO RNA polymerase-associated protein C651.09c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC651.09c PE=1 SV=1
7	P41073	2.1	35.0	716	0.014	0.024	PEP_DROME Zinc finger protein on ecdysone puffs OS=Drosophila melanogaster OX=7227 GN=Pep PE=1 SV=1
8	A8JQX6	3.1	34.3	362	0.012	0.039	A8JQX6_DROME Transcription factor Ouib OS=Drosophila melanogaster OX=7227 GN=Dmel\CG4820 PE=4 SV=1
9	P25366	5.1	33.5	362	0.022	0.072	OCA4_YEAST Protein OCA4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=OCA4 PE=1 SV=1
10	Q09776	5.1	32.7	173	0.015	0.104	SNU23_SCHPO U4/U6.U5 small nuclear ribonucleoprotein component snu23 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=snu23 PE=3 SV=4
11	O54836	6.0	33.1	290	0.017	0.072	ZMAT3_MOUSE Zinc finger matrin-type protein 3 OS=Mus musculus OX=10090 GN=Zmat3 PE=2 SV=1
12	P98161	6.6	33.5	4303	0.024	0.007	PKD1_HUMAN Polycystin-1 OS=Homo sapiens OX=9606 GN=PKD1 PE=1 SV=3
13	P22265	7.6	33.1	954	0.021	0.026	TSH_DROME Protein teashirt OS=Drosophila melanogaster OX=7227 GN=tsh PE=1 SV=2
14	Q57ZI7	8.1	32.7	260	0.013	0.062	Q57ZI7_TRYB2 60S ribosomal protein L19, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.27E10.170 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11931 SF3a60_Prp9_C	6.5	18.7	SF3a60/Prp9 C-terminal
2	PF12171 zf-C2H2_jaz	0.0036	28.8	Zinc-finger double-stranded RNA-binding
3	PF12874 zf-met	6.7e+02	12.1	Zinc-finger of C2H2 type

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303252

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000284292	0.733	Neurogranin
2	9606.ENSP00000266376	0.716	Voltage-dependent L-type calcium channel subunit alpha-1C
3	9606.ENSP00000355593	0.681	Disrupted in schizophrenia 1 protein
4	9606.ENSP00000430733	0.678	CUB and sushi domain-containing protein 1
5	9606.ENSP00000414721	0.671	WW domain binding protein 1 like
6	9606.ENSP00000280772	0.661	Ankyrin-3
7	9606.ENSP00000408002	0.661	Serine/threonine-protein kinase VRK2
8	9606.ENSP00000233078	0.650	DAZ-associated protein 1
9	9606.ENSP00000341680	0.633	Dysbindin
10	9606.ENSP00000354511	0.616	Catechol O-methyltransferase
11	9606.ENSP00000290231	0.612	Nuclear receptor coactivator 5
12	9606.ENSP00000253048	0.610	Zinc finger CCCH domain-containing protein 4
13	9606.ENSP00000223273	0.605	The complex LTO1:YAE1 functions as a target specific adapter that probably recruits apo-ABCE1 to the cytosolic iron-sulfur protein assembly (CIA) complex machinery . May be required for biogenesis of the large ribosomal subunit and initiation of translation
14	9606.ENSP00000430242	0.605	Suprabasin
15	9606.ENSP00000266070	0.600	Death-inducer obliterator 1
16	9606.ENSP00000384620	0.595	Pro-neuregulin-1, membrane-bound isoform
17	9606.ENSP00000347730	0.586	Zinc finger protein 536
18	9606.ENSP00000230582	0.559	Thymus-specific serine protease
19	9606.ENSP00000385142	0.530	Neurexin-1
20	9606.ENSP00000375909	0.521	A-kinase anchor protein SPHKAP

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0097159	0.750	organic cyclic compound binding
GO:1901363	0.733	heterocyclic compound binding
GO:0003676	0.577	nucleic acid binding
GO:0003723	0.319	RNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0010468	0.939	regulation of gene expression
GO:0048522	0.900	positive regulation of cellular process
GO:0010975	0.852	regulation of neuron projection development
GO:0009893	0.834	positive regulation of metabolic process
GO:0031346	0.796	positive regulation of cell projection organization
GO:0010604	0.759	positive regulation of macromolecule metabolic process
GO:0010976	0.751	positive regulation of neuron projection development
GO:0010628	0.719	positive regulation of gene expression
GO:0009987	0.718	cellular process
GO:0008152	0.416	metabolic process
GO:0071704	0.413	organic substance metabolic process
GO:0006807	0.379	nitrogen compound metabolic process
GO:0050896	0.309	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005634	0.999	nucleus
GO:0043005	0.990	neuron projection
GO:0005737	0.974	cytoplasm
GO:0016020	0.971	membrane
GO:0030424	0.941	axon
GO:0036477	0.939	somatodendritic compartment
GO:0030425	0.930	dendrite
GO:0045202	0.924	synapse
GO:0043228	0.915	non-membrane-bounded organelle
GO:0043198	0.903	dendritic shaft
GO:0043232	0.851	intracellular non-membrane-bounded organelle
GO:0044297	0.845	cell body
GO:0071944	0.844	cell periphery
GO:0098794	0.844	postsynapse
GO:0043025	0.840	neuronal cell body
GO:0043197	0.821	dendritic spine
GO:0005886	0.804	plasma membrane
GO:0030427	0.750	site of polarized growth
GO:0150034	0.750	distal axon
GO:0030426	0.742	growth cone
GO:0099512	0.735	supramolecular fiber
GO:0015630	0.717	microtubule cytoskeleton
GO:0005874	0.706	microtubule
GO:1901588	0.665	dendritic microtubule
GO:0070013	0.531	intracellular organelle lumen
GO:0031981	0.521	nuclear lumen
GO:0005654	0.474	nucleoplasm
GO:0012505	0.397	endomembrane system
GO:0032991	0.361	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]