StarFunc result for job id Q7Z589

User Input

>input (1322 residues)
MPVVWPTLLDLSRDECKRILRKLELEAYAGVISALRAQGDLTKEKKDLLGELSKVLSIST
ERHRAEVRRAVNDERLTTIAHNMSGPNSSSEWSIEGRRLVPLMPRLVPQTAFTVTANAVA
NAAIQHNASLPVPAETGSKEVVCYSYTSTTSTPTSTPVPSGSIATVKSPRPASPASNVVV
LPSGSTVYVKSVSCSDEDEKPRKRRRTNSSSSSPVVLKEVPKAVVPVSKTITVPVSGSPK
MSNIMQSIANSLPPHMSPVKITFTKPSTQTTNTTTQKVIIVTTSPSSTFVPNILSKSHNY
AAVTKLVPTSVIASTTQKPPVVITASQSSLVSNSSSGSSSSTPSPIPNTVAVTAVVSSTP
SVVMSTVAQGVSTSAIKMASTRLPSPKSLVSAPTQILAQFPKQHQQSPKQQLYQVQQQTQ
QQVAQPSPVSHQQQPQQSPLPPGIKPTIQIKQESGVKIITQQVQPSKILPKPVTATLPTS
SNSPIMVVSSNGAIMTTKLVTTPTGTQATYTRPTVSPSIGRMAATPGAATYVKTTSGSII
TVVPKSLATLGGKIISSNIVSGTTTKITTIPMTSKPNVIVVQKTTGKGTTIQGLPGKNVV
TTLLNAGGEKTIQTVPTGAKPAILTATRPITKMIVTQPKGIGSTVQPAAKIIPTKIVYGQ
QGKTQVLIKPKPVTFQATVVSEQTRQLVTETLQQASRVAEAGNSSIQEGKEEPQNYTDSS
SSSTESSQSSQDSQPVVHVIASRRQDWSEHEIAMETSPTIIYQDVSSESQSATSTIKALL
ELQQTTVKEKLESKPRQPTIDLSQMAVPIQMTQEKRHSPESPSIAVVESELVAEYITTER
TDEGTEVAFPLLVSHRSQPQQPSQPQRTLLQHVAQSQTATQTSVVVKSIPASSPGAITHI
MQQALSSHTAFTKHSEELGTEEGEVEEMDTLDPQTGLFYRSALTQSQSAKQQKLSQPPLE
QTQLQVKTLQCFQTKQKQTIHLQADQLQHKLPQMPQLSIRHQKLTPLQQEQAQPKPDVQH
TQHPMVAKDRQLPTLMAQPPQTVVQVLAVKTTQQLPKLQQAPNQPKIYVQPQTPQSQMSL
PASSEKQTASQVEQPIITQGSSVTKITFEGRQPPTVTKITGGSSVPKLTSPVTSISPIQA
SEKTAVSDILKMSLMEAQIDTNVEHMIVDPPKKALATSMLTGEAGSLPSTHMVVAGMANS
TPQQQKCRESCSSPSTVGSSLTTRKIDPPAVPATGQFMRIQNVGQKKAEESPAEIIIQAI
PQYAIPCHSSSNVVVEPSGLLELNNFTSQQLDDEETAMEQDIDSSTEDGTEPSPSQSSAE
RS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E9PMC9	0.104	0.112	0.000	1224	0.924	0.998	E9PMC9.pdb.gz	E9PMC9_HUMAN EMSY transcriptional repressor, BRCA2 interacting OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=1
2	AFDB:Q7Z589	0.999	0.999	0.000	1322	1.000	1.000	Q7Z589.pdb.gz	EMSY_HUMAN BRCA2-interacting transcriptional repressor EMSY OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=2
3	AFDB:Q8BMB0	0.111	0.115	0.000	1264	0.899	0.940	Q8BMB0.pdb.gz	EMSY_MOUSE BRCA2-interacting transcriptional repressor EMSY OS=Mus musculus OX=10090 GN=Emsy PE=1 SV=2
4	AFDB:Q9VQ58	0.081	0.103	6.678E-15	1023	0.172	0.222	Q9VQ58.pdb.gz	Q9VQ58_DROME FI15207p1 OS=Drosophila melanogaster OX=7227 GN=EMSY PE=1 SV=1
5	AFDB:Q8CJF7	0.042	0.031	2.060E-2	2243	0.156	0.092	Q8CJF7.pdb.gz	ELYS_MOUSE Protein ELYS OS=Mus musculus OX=10090 GN=Ahctf1 PE=1 SV=1
6	AFDB:Q5VT52	0.038	0.037	3.133E-2	1461	0.166	0.150	Q5VT52.pdb.gz	RPRD2_HUMAN Regulation of nuclear pre-mRNA domain-containing protein 2 OS=Homo sapiens OX=9606 GN=RPRD2 PE=1 SV=1
7	AFDB:Q9V4D4	0.047	0.043	1.401E-1	1406	0.157	0.148	Q9V4D4.pdb.gz	Q9V4D4_DROME Bip2 OS=Drosophila melanogaster OX=7227 GN=Taf3 PE=1 SV=1
8	AFDB:Q9VMV5	0.034	0.025	1.677E-1	1940	0.133	0.091	Q9VMV5.pdb.gz	Q9VMV5_DROME Viking, isoform A OS=Drosophila melanogaster OX=7227 GN=vkg PE=1 SV=1
9	PDB:7q83D	0.037	0.189	2.697E-1	156	0.012	0.103	7q83D.pdb.gz
10	AFDB:Q8WYP5	0.041	0.029	2.708E-1	2266	0.152	0.089	Q8WYP5.pdb.gz	ELYS_HUMAN Protein ELYS OS=Homo sapiens OX=9606 GN=AHCTF1 PE=1 SV=3
11	PDB:5n9jV	0.028	0.237	3.229E-1	99	0.017	0.232	5n9jV.pdb.gz
12	AFDB:O15054	0.047	0.040	3.241E-1	1643	0.121	0.097	O15054.pdb.gz	KDM6B_HUMAN Lysine-specific demethylase 6B OS=Homo sapiens OX=9606 GN=KDM6B PE=1 SV=4
13	PDB:7shfC	0.038	0.106	1.206	400	0.011	0.037	7shfC.pdb.gz	Cryo-EM structure of human GPR158 receptor coupled to the RGS7-G beta 5 signaling complex.
14	PDB:7aqsE	0.027	0.118	1.360	159	0.012	0.101	7aqsE.pdb.gz	Identification of a Dps contamination in Mitomycin-C-induced expression of Colicin Ia.
15	PDB:7sc9AR	0.034	0.168	1.533	160	0.013	0.106	7sc9AR.pdb.gz	Structures of a phycobilisome in light-harvesting and photoprotected states.
16	PDB:6gn0A	0.031	0.115	1.628	239	0.011	0.063	6gn0A.pdb.gz
17	PDB:3c98B	0.037	0.151	1.728	230	0.011	0.061	3c98B.pdb.gz
18	PDB:7pubFh	0.049	0.139	1.728	274	0.020	0.095	7pubFh.pdb.gz	Mitoribosomal small subunit maturation involves formation of initiation-like complexes.
19	PDB:2kn6A	0.032	0.118	1.835	195	0.015	0.103	2kn6A.pdb.gz
20	PDB:7siiA	0.027	0.075	1.948	324	0.015	0.062	7siiA.pdb.gz	Activation of STING by targeting a pocket in the transmembrane domain.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	E9PMC9	0.0	1618	1224	0.646	0.698	E9PMC9_HUMAN EMSY transcriptional repressor, BRCA2 interacting OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=1
2	Q7Z589	0.0	2612	1322	1.000	1.000	EMSY_HUMAN BRCA2-interacting transcriptional repressor EMSY OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=2
3	Q8BMB0	0.0	2082	1264	0.900	0.941	EMSY_MOUSE BRCA2-interacting transcriptional repressor EMSY OS=Mus musculus OX=10090 GN=Emsy PE=1 SV=2
4	H0YET8	2.99e-149	454	295	0.175	0.783	H0YET8_HUMAN EMSY transcriptional repressor, BRCA2 interacting (Fragment) OS=Homo sapiens OX=9606 GN=EMSY PE=1 SV=1
5	Q9VQ58	2.14e-42	171	1023	0.057	0.074	Q9VQ58_DROME FI15207p1 OS=Drosophila melanogaster OX=7227 GN=EMSY PE=1 SV=1
6	Q08A72	5.26e-05	49.7	429	0.020	0.063	EML4_ARATH Protein EMSY-LIKE 4 OS=Arabidopsis thaliana OX=3702 GN=EML4 PE=2 SV=1
7	A6YRS1	6.38e-04	46.2	452	0.018	0.053	A6YRS1_MAIZE R-interacting factor 1 OS=Zea mays OX=4577 GN=rif1 PE=1 SV=1
8	F4K2F0	0.002	45.1	397	0.023	0.076	EML3_ARATH Protein EMSY-LIKE 3 OS=Arabidopsis thaliana OX=3702 GN=EML3 PE=1 SV=1
9	Q9C7C4	0.007	42.7	327	0.017	0.070	EML1_ARATH Protein EMSY-LIKE 1 OS=Arabidopsis thaliana OX=3702 GN=EML1 PE=1 SV=1
10	A0A509ASE5	0.012	42.7	5367	0.064	0.016	A0A509ASE5_PLABA Protein SOC2 OS=Plasmodium berghei (strain Anka) OX=5823 GN=PBANKA_1442200 PE=4 SV=1
11	M9PCJ6	0.029	41.6	18641	0.060	0.004	M9PCJ6_DROME Dumpy, isoform S OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1
12	M9PC48	0.030	41.6	18095	0.060	0.004	M9PC48_DROME Dumpy, isoform Y OS=Drosophila melanogaster OX=7227 GN=dpy PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03735 ENT	5.9e-24	95.2	ENT domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000020450

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000002985	0.957	Chromobox homolog 1
2	61853.ENSNLEP00000003880	0.932	PHD finger protein 12
3	61853.ENSNLEP00000006781	0.893	SIN3 transcription regulator family member B
4	61853.ENSNLEP00000016148	0.882	SIN3 transcription regulator family member A
5	61853.ENSNLEP00000010671	0.881	Mortality factor 4 like 1
6	61853.ENSNLEP00000003395	0.857	AT rich interactive domain 4B (RBP1-like)
7	61853.ENSNLEP00000023853	0.853	AT rich interactive domain 4A (RBP1-like)
8	61853.ENSNLEP00000000443	0.849	SDS3 homolog, SIN3A corepressor complex component
9	61853.ENSNLEP00000009727	0.829	Inhibitor of growth family, member 1
10	61853.ENSNLEP00000003167	0.822	Histone deacetylase 1
11	61853.ENSNLEP00000015855	0.822	Responsible for the deacetylation of lysine residues on the N-terminal part of the core histones (H2A, H2B, H3 and H4). Histone deacetylation gives a tag for epigenetic repression and plays an important role in transcriptional regulation, cell cycle progression and developmental events. Histone deacetylases act via the formation of large multiprotein complexes
12	61853.ENSNLEP00000002465	0.816	Lysine (K)-specific demethylase 5A
13	61853.ENSNLEP00000021988	0.813	Lysine (K)-specific demethylase 5B
14	61853.ENSNLEP00000019325	0.802	Lysine (K)-specific demethylase 5C
15	61853.ENSNLEP00000019244	0.795	Sin3A-associated protein, 130kDa
16	61853.ENSNLEP00000001277	0.779	BRCA2, DNA repair associated
17	61853.ENSNLEP00000011664	0.740	RB binding protein 7, chromatin remodeling factor
18	61853.ENSNLEP00000003509	0.729	RB binding protein 4, chromatin remodeling factor
19	61853.ENSNLEP00000016175	0.725	Zinc finger, MYND-type containing 11
20	61853.ENSNLEP00000003398	0.707	Lysine (K)-specific demethylase 6A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0065007	0.988	biological regulation
GO:0050794	0.970	regulation of cellular process
GO:0010468	0.956	regulation of gene expression
GO:0019219	0.955	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.906	regulation of RNA metabolic process
GO:0010556	0.807	regulation of macromolecule biosynthetic process
GO:0048518	0.799	positive regulation of biological process
GO:0031326	0.778	regulation of cellular biosynthetic process
GO:0048522	0.708	positive regulation of cellular process
GO:0006355	0.685	regulation of DNA-templated transcription
GO:0009987	0.672	cellular process
GO:0008152	0.585	metabolic process
GO:0006807	0.544	nitrogen compound metabolic process
GO:0071704	0.506	organic substance metabolic process
GO:0010604	0.492	positive regulation of macromolecule metabolic process
GO:0051173	0.468	positive regulation of nitrogen compound metabolic process
GO:0044238	0.465	primary metabolic process
GO:0031325	0.465	positive regulation of cellular metabolic process
GO:0045935	0.447	positive regulation of nucleobase-containing compound metabolic process
GO:0050896	0.423	response to stimulus
GO:0032501	0.395	multicellular organismal process
GO:0043170	0.394	macromolecule metabolic process
GO:0048519	0.383	negative regulation of biological process
GO:0048523	0.354	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.710	protein-containing complex
GO:0043232	0.484	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]