StarFunc result for job id Q7Z591

User Input

>input (1439 residues)
MASSETEIRWAEPGLGKGPQRRRWAWAEDKRDVDRSSSQSWEEERLFPNATSPELLEDFR
LAQQHLPPLEWDPHPQPDGHQDSESGETSGEEAEAEDVDSPASSHEPLAWLPQQGRQLDM
TEEEPDGTLGSLEVEEAGESSSRLGYEAGLSLEGHGNTSPMALGHGQARGWVASGEQASG
DKLSEHSEVNPSVELSPARSWSSGTVSLDHPSDSLDSTWEGETDGPQPTALAETLPEGPS
HHLLSPDGRTGGSVARATPMEFQDSSAPPAQSPQHATDRWRRETTRFFCPQPKEHIWKQT
KTSPKPLPSRFIGSISPLNPQPRPTRQGRPLPRQGATLAGRSSSNAPKYGRGQLNYPLPD
FSKVGPRVRFPKDESYRPPKSRSHNRKPQAPARPLIFKSPAEIVQEVLLSSGEAALAKDT
PPAHPITRVPQEFQTPEQATELVHQLQEDYHRLLTKYAEAENTIDQLRLGAKVNLFSDPP
QPNHSIHTGMVPQGTKVLSFTIPQPRSAEWWPGPAEDPQASAASGWPSARGDLSPSSLTS
MPTLGWLPENRDISEDQSSAEQTQALASQASQFLAKVESFERLIQAGRLMPQDQVKGFQR
LKAAHAALEEEYLKACREQHPAQPLAGSKGTPGRFDPRRELEAEIYRLGSCLEELKEHID
QTQQEPEPPGSDSALDSTPALPCLHQPTHLPAPSGQAPMPAIKTSCPEPATTTAAASTGP
CPLHVNVEVSSGNSEVEDRPQDPLARLRHKELQMEQVYHGLMERYLSVKSLPEAMRMEEE
EEGEEEEEEEGGGDSLEVDGVAATPGKAEATRVLPRQCPVQAEKSHGAPLEEATEKMVSM
KPPGFQASLARDGHMSGLGKAEAAPPGPGVPPHPPGTKSAASHQSSMTSLEGSGISERLP
QKPLHRGGGPHLEETWMASPETDSGFVGSETSRVSPLTQTPEHRLSHISTAGTLAQPFAA
SVPRDGASYPKARGSLIPRRATEPSTPRSQAQRYLSSPSGPLRQRAPNFSLERTLAAEMA
VPGSEFEGHKRISEQPLPNKTISPPPAPAPAAAPLPCGPTETIPSFLLTRAGRDQAICEL
QEEVSRLRLRLEDSLHQPLQGSPTRPASAFDRPARTRGRPADSPATWGSHYGSKSTERLP
GEPRGEEQIVPPGRQRARSSSVPREVLRLSLSSESELPSLPLFSEKSKTTKDSPQAARDG
KRGVGSAGWPDRVTFRGQYTGHEYHVLSPKAVPKGNGTVSCPHCRPIRTQDAGGAVTGDP
LGPPPADTLQCPLCGQVGSPPEADGPGSATSGAEKATTRRKASSTPSPKQRSKQAGSSPR
PPPGLWYLATAPPAPAPPAFAYISSVPIMPYPPAAVYYAPAGPTSAQPAAKWPPTASPPP
ARRHRHSIQLDLGDLEELNKALSRAVQAAESVRSTTRQMRSSLSADLRQAHSLRGSCLF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z591	1.000	1.000	0.000	1439	1.000	1.000	Q7Z591.pdb.gz	AKNA_HUMAN Microtubule organization protein AKNA OS=Homo sapiens OX=9606 GN=AKNA PE=1 SV=2
2	AFDB:Q80VW7	0.150	0.153	3.328E-98	1404	0.580	0.594	Q80VW7.pdb.gz	AKNA_MOUSE Microtubule organization protein AKNA OS=Mus musculus OX=10090 GN=Akna PE=1 SV=1
3	AFDB:Q6ZU65	0.050	0.052	4.693E-6	1347	0.133	0.143	Q6ZU65.pdb.gz	UBN2_HUMAN Ubinuclein-2 OS=Homo sapiens OX=9606 GN=UBN2 PE=1 SV=2
4	AFDB:Q9ESU6	0.042	0.043	5.859E-5	1400	0.137	0.141	Q9ESU6.pdb.gz	BRD4_MOUSE Bromodomain-containing protein 4 OS=Mus musculus OX=10090 GN=Brd4 PE=1 SV=2
5	AFDB:Q57Y65	0.046	0.042	2.633E-4	1617	0.135	0.120	Q57Y65.pdb.gz	Q57Y65_TRYB2 Uncharacterized protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.15M23.280 PE=4 SV=1
6	AFDB:Q9R0I7	0.057	0.059	2.796E-4	1386	0.131	0.136	Q9R0I7.pdb.gz	YLPM1_MOUSE YLP motif-containing protein 1 OS=Mus musculus OX=10090 GN=Ylpm1 PE=2 SV=2
7	AFDB:Q8IY92	0.052	0.045	1.183E-3	1834	0.157	0.123	Q8IY92.pdb.gz	SLX4_HUMAN Structure-specific endonuclease subunit SLX4 OS=Homo sapiens OX=9606 GN=SLX4 PE=1 SV=3
8	AFDB:Q7TPM1	0.048	0.047	1.417E-3	1486	0.172	0.166	Q7TPM1.pdb.gz	PRC2B_MOUSE Protein PRRC2B OS=Mus musculus OX=10090 GN=Prrc2b PE=1 SV=1
9	AFDB:P21263	0.035	0.027	1.802E-3	1893	0.158	0.120	P21263.pdb.gz	NEST_RAT Nestin OS=Rattus norvegicus OX=10116 GN=Nes PE=1 SV=2
10	AFDB:O60885	0.048	0.050	2.158E-3	1362	0.133	0.140	O60885.pdb.gz	BRD4_HUMAN Bromodomain-containing protein 4 OS=Homo sapiens OX=9606 GN=BRD4 PE=1 SV=2
11	PDB:7nsuD	0.039	0.112	2.342E-1	420	0.008	0.026	7nsuD.pdb.gz
12	PDB:2jmhA	0.062	0.516	2.978E-1	117	0.015	0.179	2jmhA.pdb.gz
13	PDB:3c98B	0.061	0.274	3.567E-1	230	0.011	0.070	3c98B.pdb.gz
14	PDB:7be8A	0.047	0.193	3.788E-1	219	0.013	0.082	7be8A.pdb.gz	Repair of Iron Center Proteins-A Different Class of Hemerythrin-like Proteins.
15	PDB:7o4i1	0.049	0.105	4.536E-1	522	0.022	0.059	7o4i1.pdb.gz	Structure of RNA polymerase II pre-initiation complex at 2.9 angstrom defines initial DNA opening.
16	PDB:5bw9g	0.041	0.305	5.116E-1	141	0.010	0.099	5bw9g.pdb.gz
17	PDB:7rroB0	0.040	0.253	5.116E-1	189	0.010	0.079	7rroB0.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	PDB:7vrcC	0.044	0.451	6.506E-1	109	0.013	0.165	7vrcC.pdb.gz
19	PDB:3k29A	0.045	0.361	7.337E-1	162	0.010	0.086	3k29A.pdb.gz
20	PDB:5ew5A	0.040	0.109	7.337E-1	490	0.007	0.020	5ew5A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z591	0.0	2874	1439	1.000	1.000	AKNA_HUMAN Microtubule organization protein AKNA OS=Homo sapiens OX=9606 GN=AKNA PE=1 SV=2
2	Q80VW7	0.0	1362	1404	0.584	0.598	AKNA_MOUSE Microtubule organization protein AKNA OS=Mus musculus OX=10090 GN=Akna PE=1 SV=1
3	Q5T1N1	9.31e-06	52.8	836	0.031	0.053	AKND1_HUMAN Protein AKNAD1 OS=Homo sapiens OX=9606 GN=AKNAD1 PE=1 SV=3
4	E9KL37	1.3	36.2	1012	0.028	0.041	E9KL37_HUMAN Epididymis tissue sperm binding protein Li 5a OS=Homo sapiens OX=9606 GN=OFD1 PE=2 SV=1
5	O75665	1.3	36.2	1012	0.028	0.041	OFD1_HUMAN Centriole and centriolar satellite protein OFD1 OS=Homo sapiens OX=9606 GN=OFD1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12443 AKNA	2.5e-38	141.9	AT-hook-containing transcription factor
2	PF20072 DUF6468	38	15.8	Domain of unknown function (DUF6468)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000303769

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000289429	0.730	T-cell surface glycoprotein CD1a
2	9606.ENSP00000357149	0.657	T-cell surface glycoprotein CD1e, membrane-associated
3	9606.ENSP00000381607	0.645	Glutathione S-transferase P
4	9606.ENSP00000358529	0.594	Tetraspanin-2
5	9606.ENSP00000312631	0.591	Insulinoma-associated protein 1
6	9606.ENSP00000361057	0.589	Surfeit locus protein 4
7	9606.ENSP00000300403	0.588	Targeting protein for Xklp2
8	9606.ENSP00000280758	0.583	Ankyrin repeat and BTB/POZ domain-containing protein BTBD11
9	9606.ENSP00000357152	0.582	T-cell surface glycoprotein CD1c
10	9606.ENSP00000357150	0.580	T-cell surface glycoprotein CD1b
11	9606.ENSP00000306523	0.518	Insulinoma-associated protein 2
12	9606.ENSP00000357153	0.517	Antigen-presenting glycoprotein CD1d

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0051171	0.966	regulation of nitrogen compound metabolic process
GO:0080090	0.965	regulation of primary metabolic process
GO:0060255	0.964	regulation of macromolecule metabolic process
GO:0031323	0.964	regulation of cellular metabolic process
GO:0048518	0.955	positive regulation of biological process
GO:0009889	0.943	regulation of biosynthetic process
GO:0010556	0.933	regulation of macromolecule biosynthetic process
GO:0010468	0.928	regulation of gene expression
GO:0048522	0.919	positive regulation of cellular process
GO:0009987	0.908	cellular process
GO:0019219	0.866	regulation of nucleobase-containing compound metabolic process
GO:0051252	0.843	regulation of RNA metabolic process
GO:2001141	0.767	regulation of RNA biosynthetic process
GO:1903506	0.707	regulation of nucleic acid-templated transcription
GO:0006355	0.674	regulation of DNA-templated transcription
GO:0009893	0.560	positive regulation of metabolic process
GO:0010604	0.549	positive regulation of macromolecule metabolic process
GO:0051173	0.450	positive regulation of nitrogen compound metabolic process
GO:0031325	0.448	positive regulation of cellular metabolic process
GO:0006357	0.415	regulation of transcription by RNA polymerase II
GO:0045935	0.397	positive regulation of nucleobase-containing compound metabolic process
GO:0051254	0.327	positive regulation of RNA metabolic process
GO:0045893	0.320	positive regulation of DNA-templated transcription
GO:0048523	0.313	negative regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005813	1.000	centrosome
GO:0005737	0.999	cytoplasm
GO:0005654	0.996	nucleoplasm
GO:0016020	0.995	membrane
GO:0005829	0.989	cytosol
GO:0005730	0.937	nucleolus
GO:0001650	0.735	fibrillar center
GO:0012505	0.587	endomembrane system
GO:0071944	0.533	cell periphery
GO:0005886	0.497	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]