StarFunc result for job id Q7Z5A8

User Input

>input (133 residues)
MSERVERNWSTGGWLLALCLAWLWTHLTLAALQPPTATVLVQQGTCEVIAAHRCCNRNRI
EERSQTVKCSCFSGQVAGTTRAKPSCVDASIVLQRWWCQMEPCLPGEECKVLPDLSGWSC
SSGHKVKTTKVTR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z5A8	1.000	1.000	5.915E-25	133	1.000	1.000	Q7Z5A8.pdb.gz	TAFA3_HUMAN Chemokine-like protein TAFA-3 OS=Homo sapiens OX=9606 GN=TAFA3 PE=2 SV=1
2	AFDB:Q7TPG6	0.772	0.778	8.223E-21	132	0.842	0.848	Q7TPG6.pdb.gz	TAFA3_MOUSE Chemokine-like protein TAFA-3 OS=Mus musculus OX=10090 GN=Tafa3 PE=2 SV=1
3	AFDB:Q96LR4	0.690	0.656	8.663E-18	140	0.609	0.579	Q96LR4.pdb.gz	TAFA4_HUMAN Chemokine-like protein TAFA-4 OS=Homo sapiens OX=9606 GN=TAFA4 PE=1 SV=1
4	AFDB:Q7TPG7	0.676	0.686	2.131E-17	131	0.617	0.626	Q7TPG7.pdb.gz	TAFA2_MOUSE Chemokine-like protein TAFA-2 OS=Mus musculus OX=10090 GN=Tafa2 PE=1 SV=1
5	AFDB:Q7TPG8	0.659	0.659	1.053E-15	133	0.579	0.579	Q7TPG8.pdb.gz	TAFA1_MOUSE Chemokine-like protein TAFA-1 OS=Mus musculus OX=10090 GN=Tafa1 PE=1 SV=1
6	AFDB:M0R7X9	0.684	0.689	5.277E-12	132	0.353	0.356	M0R7X9.pdb.gz	TAFA5_RAT Chemokine-like protein TAFA-5 OS=Rattus norvegicus OX=10116 GN=Tafa5 PE=1 SV=1
7	AFDB:Q9VD83	0.268	0.210	3.048E-1	173	0.173	0.133	Q9VD83.pdb.gz	BURS_DROME Bursicon OS=Drosophila melanogaster OX=7227 GN=Burs PE=1 SV=1
8	AFDB:Q86YW7	0.172	0.175	7.497E-1	130	0.135	0.138	Q86YW7.pdb.gz	GPHB5_HUMAN Glycoprotein hormone beta-5 OS=Homo sapiens OX=9606 GN=GPHB5 PE=1 SV=1
9	AFDB:O35516	0.180	0.021	7.960E-1	2473	0.195	0.011	O35516.pdb.gz	NOTC2_MOUSE Neurogenic locus notch homolog protein 2 OS=Mus musculus OX=10090 GN=Notch2 PE=1 SV=2
10	AFDB:A0A090XE98	0.183	0.252	8.452E-1	91	0.090	0.132	A0A090XE98.pdb.gz	E1077_IXORI Evasin P1077 (Fragment) OS=Ixodes ricinus OX=34613 PE=2 SV=1
11	PDB:5lj5t	0.183	0.065	2.201	438	0.113	0.034	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
12	PDB:6q2sA	0.129	0.172	2.337	98	0.113	0.153	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.
13	PDB:5an9B	0.164	0.119	2.798	188	0.075	0.053	5an9B.pdb.gz	Mechanism of Eif6 Release from the Nascent 60S Ribosomal Subunit
14	PDB:6drtA	0.186	0.115	2.798	230	0.038	0.022	6drtA.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
15	PDB:3j6bS	0.145	0.134	3.155	146	0.030	0.027	3j6bS.pdb.gz	Structure of the yeast mitochondrial large ribosomal subunit.
16	PDB:7mq8L8	0.142	0.109	3.557	180	0.090	0.067	7mq8L8.pdb.gz	Nucleolar maturation of the human small subunit processome.
17	PDB:7bfqB	0.157	0.048	4.010	590	0.053	0.012	7bfqB.pdb.gz
18	PDB:1ub4C	0.092	0.159	4.258	75	0.053	0.093	1ub4C.pdb.gz
19	PDB:6u23A	0.151	0.045	4.258	583	0.113	0.026	6u23A.pdb.gz
20	PDB:6zhtB	0.155	0.140	4.801	153	0.045	0.039	6zhtB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z5A8	3.54e-94	269	133	1.000	1.000	TAFA3_HUMAN Chemokine-like protein TAFA-3 OS=Homo sapiens OX=9606 GN=TAFA3 PE=2 SV=1
2	Q7TPG6	1.38e-78	229	132	0.857	0.864	TAFA3_MOUSE Chemokine-like protein TAFA-3 OS=Mus musculus OX=10090 GN=Tafa3 PE=2 SV=1
3	Q96LR4	3.29e-54	168	140	0.579	0.550	TAFA4_HUMAN Chemokine-like protein TAFA-4 OS=Homo sapiens OX=9606 GN=TAFA4 PE=1 SV=1
4	Q7TPG7	4.60e-53	165	131	0.617	0.626	TAFA2_MOUSE Chemokine-like protein TAFA-2 OS=Mus musculus OX=10090 GN=Tafa2 PE=1 SV=1
5	Q7TPG5	3.29e-52	163	135	0.564	0.556	TAFA4_MOUSE Chemokine-like protein TAFA-4 OS=Mus musculus OX=10090 GN=Tafa4 PE=1 SV=1
6	Q7Z5A9	2.16e-47	150	133	0.511	0.511	TAFA1_HUMAN Chemokine-like protein TAFA-1 OS=Homo sapiens OX=9606 GN=TAFA1 PE=1 SV=1
7	Q7TPG8	2.23e-47	150	133	0.511	0.511	TAFA1_MOUSE Chemokine-like protein TAFA-1 OS=Mus musculus OX=10090 GN=Tafa1 PE=1 SV=1
8	Q7Z5A7	1.58e-24	93.2	132	0.361	0.364	TAFA5_HUMAN Chemokine-like protein TAFA-5 OS=Homo sapiens OX=9606 GN=TAFA5 PE=1 SV=2
9	M0R7X9	1.76e-24	92.8	132	0.361	0.364	TAFA5_RAT Chemokine-like protein TAFA-5 OS=Rattus norvegicus OX=10116 GN=Tafa5 PE=1 SV=1
10	Q91WE9	1.76e-24	92.8	132	0.361	0.364	TAFA5_MOUSE Chemokine-like protein TAFA-5 OS=Mus musculus OX=10090 GN=Tafa5 PE=1 SV=2
11	Q8BNA6	0.45	32.3	4555	0.173	0.005	FAT3_MOUSE Protocadherin Fat 3 OS=Mus musculus OX=10090 GN=Fat3 PE=1 SV=2
12	Q8IRI6	0.60	32.0	1440	0.098	0.009	GTR1_DROME Glucose transporter type 1 OS=Drosophila melanogaster OX=7227 GN=Glut1 PE=2 SV=4
13	Q03350	0.85	31.6	1172	0.098	0.011	TSP2_MOUSE Thrombospondin-2 OS=Mus musculus OX=10090 GN=Thbs2 PE=1 SV=2
14	D4A2G6	0.88	31.6	1172	0.098	0.011	D4A2G6_RAT Thrombospondin 2 OS=Rattus norvegicus OX=10116 GN=Thbs2 PE=3 SV=2
15	Q8VHS2	2.3	30.4	1405	0.098	0.009	CRUM1_MOUSE Protein crumbs homolog 1 OS=Mus musculus OX=10090 GN=Crb1 PE=1 SV=3
16	A0A2R8QAL3	2.9	30.0	4601	0.150	0.004	A0A2R8QAL3_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
17	F1QA09	2.9	30.0	4546	0.150	0.004	F1QA09_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=2
18	X1WCY4	2.9	30.0	4578	0.150	0.004	X1WCY4_DANRE FAT atypical cadherin 3a OS=Danio rerio OX=7955 GN=fat3 PE=4 SV=1
19	P35442	3.6	29.6	1172	0.098	0.011	TSP2_HUMAN Thrombospondin-2 OS=Homo sapiens OX=9606 GN=THBS2 PE=1 SV=2
20	Q9ESC1	4.2	29.3	738	0.075	0.014	AGRL4_RAT Adhesion G protein-coupled receptor L4 OS=Rattus norvegicus OX=10116 GN=Adgrl4 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF12020 TAFA	6.5e-46	166.0	TAFA family

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000016417

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000001737	0.652	Microtubule associated serine/threonine kinase 3
2	60711.ENSCSAP00000006879	0.649	Coiled-coil domain containing 94
3	60711.ENSCSAP00000000743	0.648	Methionine-sulfoxide reductase that specifically reduces methionine (R)-sulfoxide back to methionine. While in many cases methionine oxidation is the result of random oxidation following oxidative stress, methionine oxidation is also a post-translational modification that takes place on specific residues.
4	60711.ENSCSAP00000013713	0.635	WD repeat and FYVE domain containing 2
5	60711.ENSCSAP00000006017	0.558	Regulatory factor X, 2 (influences HLA class II expression)

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005102	0.965	signaling receptor binding
GO:0048018	0.945	receptor ligand activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.985	regulation of cellular process
GO:0009987	0.890	cellular process
GO:0048519	0.645	negative regulation of biological process
GO:0051239	0.555	regulation of multicellular organismal process
GO:0048583	0.495	regulation of response to stimulus
GO:0032101	0.466	regulation of response to external stimulus
GO:0065008	0.442	regulation of biological quality
GO:0048523	0.423	negative regulation of cellular process
GO:0050896	0.417	response to stimulus
GO:0050865	0.416	regulation of cell activation
GO:0043030	0.397	regulation of macrophage activation
GO:0080134	0.367	regulation of response to stress

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005615	0.999	extracellular space

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]