StarFunc result for job id Q7Z5D8

User Input

>input (188 residues)
MHRARWLTPVIPALWEAEAGRSRGQEIETILANKKQSAMPWDQDPEQSTGNYSEDEQNGK
QKWREEGEAGRKREREKEEKNEKELQDEQENKRKRENEKQKQYPEKRLVSKSLMHTLWAK
FKLNRCPTIQESLSLSFEFDMTHKQISQWFCKTRKKYNKEMSKRKHKKKHMRWRSLCCQG
WSRTPALK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A1W2PS91	0.325	0.156	5.391E-4	400	0.170	0.080	A0A1W2PS91.pdb.gz	A0A1W2PS91_HUMAN Paired box 6 OS=Homo sapiens OX=9606 GN=PAX6 PE=1 SV=1
2	AFDB:A0A0R4IQL7	0.281	0.132	1.059E-3	450	0.149	0.062	A0A0R4IQL7.pdb.gz	A0A0R4IQL7_DANRE Paired box 6b OS=Danio rerio OX=7955 GN=Pax6.2 PE=3 SV=1
3	AFDB:Q9UBX0	0.307	0.311	1.059E-3	185	0.154	0.157	Q9UBX0.pdb.gz	HESX1_HUMAN Homeobox expressed in ES cells 1 OS=Homo sapiens OX=9606 GN=HESX1 PE=1 SV=1
4	AFDB:P46639	0.254	0.124	1.213E-3	398	0.133	0.063	P46639.pdb.gz	KNAT1_ARATH Homeobox protein knotted-1-like 1 OS=Arabidopsis thaliana OX=3702 GN=KNAT1 PE=1 SV=1
5	AFDB:Q9DE09	0.311	0.186	1.298E-3	333	0.197	0.111	Q9DE09.pdb.gz	HMX1_CHICK Homeobox protein HMX1 OS=Gallus gallus OX=9031 GN=HMX1 PE=2 SV=1
6	AFDB:P46640	0.251	0.156	1.485E-3	310	0.160	0.097	P46640.pdb.gz	KNAT2_ARATH Homeobox protein knotted-1-like 2 OS=Arabidopsis thaliana OX=3702 GN=KNAT2 PE=1 SV=3
7	AFDB:V5ZE41	0.323	0.224	1.589E-3	276	0.128	0.087	V5ZE41.pdb.gz	V5ZE41_DANRE Paired box 10 OS=Danio rerio OX=7955 GN=pax10 PE=2 SV=1
8	AFDB:Q8L7H4	0.362	0.106	1.946E-3	709	0.144	0.038	Q8L7H4.pdb.gz	HDG4_ARATH Homeobox-leucine zipper protein HDG4 OS=Arabidopsis thaliana OX=3702 GN=HDG4 PE=1 SV=1
9	AFDB:B3DGX6	0.296	0.340	2.082E-3	161	0.160	0.186	B3DGX6.pdb.gz
10	AFDB:A2RU54	0.317	0.228	2.383E-3	273	0.112	0.077	A2RU54.pdb.gz	HMX2_HUMAN Homeobox protein HMX2 OS=Homo sapiens OX=9606 GN=HMX2 PE=2 SV=1
11	PDB:4egcA	0.232	0.085	1.963E-1	539	0.069	0.024	4egcA.pdb.gz	Structure-function analyses of the human SIX1-EYA2 complex reveal insights into metastasis and BOR syndrome.
12	PDB:2hi3A	0.246	0.566	7.583E-1	73	0.053	0.137	2hi3A.pdb.gz
13	PDB:6hivAg	0.163	0.132	4.105	259	0.160	0.116	6hivAg.pdb.gz	Evolutionary shift toward protein-based architecture in trypanosomal mitochondrial ribosomes.
14	PDB:7qsmW	0.133	0.203	4.392	116	0.048	0.078	7qsmW.pdb.gz	Cryo-EM structures define ubiquinone-10 binding to mitochondrial complex I and conformational transitions accompanying Q-site occupancy.
15	PDB:7b93E	0.185	0.165	6.157	215	0.037	0.033	7b93E.pdb.gz	Cork-in-bottle mechanism of inhibitor binding to mammalian complex I.
16	PDB:2cg4A	0.192	0.234	6.587	149	0.037	0.047	2cg4A.pdb.gz	Structural Insight Into Gene Transcriptional Regulation and Effector Binding by the Lrp/Asnc Family.
17	PDB:5ganG	0.200	0.127	7.047	318	0.144	0.085	5ganG.pdb.gz	Cryo-EM structure of the yeast U4/U6.U5 tri-snRNP at 3.7 angstrom resolution.
18	PDB:2jowA	0.227	0.406	7.540	83	0.059	0.133	2jowA.pdb.gz
19	PDB:7azyH	0.207	0.207	7.540	188	0.101	0.101	7azyH.pdb.gz	Context-specific action of macrolide antibiotics on the eukaryotic ribosome.
20	PDB:3hrdD	0.184	0.211	8.067	160	0.037	0.044	3hrdD.pdb.gz	The Mo-Se active site of nicotinate dehydrogenase

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	J3KRB9	2.58e-09	57.8	574	0.133	0.044	J3KRB9_HUMAN Sperm antigen with calponin homology and coiled-coil domains 1 OS=Homo sapiens OX=9606 GN=SPECC1 PE=1 SV=2
2	Q05481	2.36e-08	55.1	1191	0.122	0.019	ZNF91_HUMAN Zinc finger protein 91 OS=Homo sapiens OX=9606 GN=ZNF91 PE=2 SV=2
3	P49796	1.68e-07	52.8	1198	0.122	0.019	RGS3_HUMAN Regulator of G-protein signaling 3 OS=Homo sapiens OX=9606 GN=RGS3 PE=1 SV=2
4	Q9NRJ1	4.14e-04	40.4	99	0.090	0.172	MOST1_HUMAN Protein MOST-1 OS=Homo sapiens OX=9606 GN=C8orf17 PE=1 SV=1
5	Q96QL7	0.001	40.8	318	0.096	0.057	Q96QL7_HUMAN ATF6B protein OS=Homo sapiens OX=9606 GN=ATF6B PE=1 SV=1
6	Q8IK84	0.003	40.4	5906	0.096	0.003	Q8IK84_PLAF7 Cysteine repeat modular protein 4 OS=Plasmodium falciparum (isolate 3D7) OX=36329 GN=PF3D7_1475400 PE=4 SV=2
7	Q63955	0.040	36.2	338	0.165	0.092	PO4F3_MOUSE POU domain, class 4, transcription factor 3 OS=Mus musculus OX=10090 GN=Pou4f3 PE=1 SV=2
8	Q15319	0.042	36.2	338	0.165	0.092	PO4F3_HUMAN POU domain, class 4, transcription factor 3 OS=Homo sapiens OX=9606 GN=POU4F3 PE=1 SV=1
9	Q6XZH1	0.051	36.2	384	0.165	0.081	Q6XZH1_DANRE POU domain protein OS=Danio rerio OX=7955 GN=brn-3b PE=2 SV=1
10	P17208	0.069	35.8	421	0.149	0.067	PO4F1_MOUSE POU domain, class 4, transcription factor 1 OS=Mus musculus OX=10090 GN=Pou4f1 PE=1 SV=3
11	P20266	0.069	35.8	420	0.149	0.067	PO4F1_RAT POU domain, class 4, transcription factor 1 OS=Rattus norvegicus OX=10116 GN=Pou4f1 PE=2 SV=3
12	Q01851	0.071	35.8	419	0.149	0.067	PO4F1_HUMAN POU domain, class 4, transcription factor 1 OS=Homo sapiens OX=9606 GN=POU4F1 PE=1 SV=4
13	Q12837	0.096	35.4	409	0.165	0.076	PO4F2_HUMAN POU domain, class 4, transcription factor 2 OS=Homo sapiens OX=9606 GN=POU4F2 PE=1 SV=2
14	G3V7L5	0.12	35.0	412	0.165	0.075	PO4F2_RAT POU domain, class 4, transcription factor 2 OS=Rattus norvegicus OX=10116 GN=Pou4f2 PE=1 SV=1
15	Q63934	0.12	35.0	411	0.165	0.075	PO4F2_MOUSE POU domain, class 4, transcription factor 2 OS=Mus musculus OX=10090 GN=Pou4f2 PE=1 SV=1
16	Q90435	0.17	34.3	331	0.160	0.091	PO4F3_DANRE POU domain, class 4, transcription factor 3 OS=Danio rerio OX=7955 GN=pou4f3 PE=2 SV=2
17	A0A590UK51	0.29	33.9	820	0.074	0.017	A0A590UK51_HUMAN phospholipase A2 OS=Homo sapiens OX=9606 GN=PLA2G6 PE=1 SV=1
18	Q8VDM4	0.30	33.9	908	0.101	0.021	PSMD2_MOUSE 26S proteasome non-ATPase regulatory subunit 2 OS=Mus musculus OX=10090 GN=Psmd2 PE=1 SV=1
19	B8ZZN6	0.31	33.1	146	0.085	0.110	B8ZZN6_HUMAN Small ubiquitin like modifier 1 OS=Homo sapiens OX=9606 GN=SUMO1 PE=1 SV=1
20	A0A1C7CYV8	0.33	33.9	611	0.138	0.043	A0A1C7CYV8_HUMAN POU domain protein OS=Homo sapiens OX=9606 GN=POU6F1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02724 CDC45	4.7e+02	10.4	CDC45-like protein
2	PF17943 HOCHOB	4.3	19.5	Homeobox-cysteine loop-homeobox
3	PF00046 Homeodomain	0.1	23.8	Homeodomain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000371553

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000323455	0.630	Tetra-peptide repeat homeobox protein 1
2	9606.ENSP00000335578	0.612	Arginine-fifty homeobox
3	9606.ENSP00000439513	0.610	Anomalous homeobox
4	9606.ENSP00000365838	0.605	Divergent paired-related homeobox
5	9606.ENSP00000229335	0.594	Single-stranded DNA cytosine deaminase
6	9606.ENSP00000360455	0.594	Rhox homeobox family member 2B
7	9606.ENSP00000346275	0.588	PRAME family member 20
8	9606.ENSP00000365266	0.572	PRAME family member 17
9	9606.ENSP00000346453	0.571	Importin-4
10	9606.ENSP00000380053	0.559	PRD class homeoboxes and pseudogenes
11	9606.ENSP00000433967	0.534	Transmembrane 9 superfamily member 1
12	9606.ENSP00000075120	0.521	Solute carrier family 2, facilitated glucose transporter member 3
13	9606.ENSP00000452398	0.520	Double homeobox protein A
14	9606.ENSP00000482241	0.518	annotation not available
15	9606.ENSP00000484601	0.517	Cancer/testis antigen family 45 member A5
16	9606.ENSP00000261789	0.515	Transmembrane 9 superfamily member

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0043565	0.995	sequence-specific DNA binding
GO:0003700	0.990	DNA-binding transcription factor activity
GO:0003690	0.925	double-stranded DNA binding
GO:1990837	0.913	sequence-specific double-stranded DNA binding
GO:0000981	0.704	DNA-binding transcription factor activity, RNA polymerase II-specific
GO:0000976	0.355	transcription cis-regulatory region binding
GO:0000977	0.315	RNA polymerase II transcription regulatory region sequence-specific DNA binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.998	regulation of biological process
GO:0019222	0.991	regulation of metabolic process
GO:0060255	0.983	regulation of macromolecule metabolic process
GO:0010468	0.973	regulation of gene expression
GO:0080090	0.959	regulation of primary metabolic process
GO:0031323	0.959	regulation of cellular metabolic process
GO:0051171	0.958	regulation of nitrogen compound metabolic process
GO:0010556	0.932	regulation of macromolecule biosynthetic process
GO:0031326	0.932	regulation of cellular biosynthetic process
GO:0019219	0.916	regulation of nucleobase-containing compound metabolic process
GO:2001141	0.838	regulation of RNA biosynthetic process
GO:1903506	0.823	regulation of nucleic acid-templated transcription
GO:0006355	0.781	regulation of DNA-templated transcription
GO:0048523	0.580	negative regulation of cellular process
GO:0048518	0.449	positive regulation of biological process
GO:0032501	0.425	multicellular organismal process
GO:0009987	0.361	cellular process
GO:0010605	0.328	negative regulation of macromolecule metabolic process
GO:0010558	0.313	negative regulation of macromolecule biosynthetic process
GO:0031327	0.311	negative regulation of cellular biosynthetic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0031981	0.998	nuclear lumen
GO:0005654	0.885	nucleoplasm
GO:0043228	0.869	non-membrane-bounded organelle
GO:0043232	0.863	intracellular non-membrane-bounded organelle
GO:0005737	0.321	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]