StarFunc result for job id Q7Z5H3

User Input

>input (698 residues)
MLSPKIRQARRARSKSLVMGEQSRSPGRMPCPHRLGPVLKAGWLKKQRSIMKNWQQRWFV
LRGDQLFYYKDKDEIKPQGFISLQGTQVTELPPGPEDPGKHLFEISPGGAGEREKVPANP
EALLLMASSQRDMEDWVQAIRRVIWAPLGGGIFGQRLEETVHHERKYGPRLAPLLVEQCV
DFIRERGLTEEGLFRMPGQANLVRDLQDSFDCGEKPLFDSTTDVHTVASLLKLYLRELPE
PVVPFARYEDFLSCAQLLTKDEGEGTLELAKQVSNLPQANYNLLRYICKFLDEVQAYSNV
NKMSVQNLATVFGPNILRPQVEDPVTIMEGTSLVQHLMTVLIRKHSQLFTAPVPEGPTSP
RGGLQCAVGWGSEEVTRDSQGEPGGPGLPAHRTSSLDGAAVAVLSRTAPTGPGSRCSPGK
KVQTLPSWKSSFRQPRSLSGSPKGGGSSLEVPIISSGGNWLMNGLSSLRGHRRASSGDRL
KDSGSVQRLSTYDNVPAPGLVPGIPSVASMAWSGASSSESSVGGSLSSCTACRASDSSAR
SSLHTDWALEPSPLPSSSEDPKSLDLDHSMDEAGAGASNSEPSEPDSPTREHARRSEALQ
GLVTELRAELCRQRTEYERSVKRIEEGSADLRKRMSRLEEELDQEKKKYIMLEIKLRNSE
RAREDAERRNQLLQREMEEFFSTLGSLTVGAKGARAPK

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z5H3	1.000	1.000	2.383E-95	698	1.000	1.000	Q7Z5H3.pdb.gz	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
2	AFDB:Q8N264	0.446	0.416	5.870E-52	748	0.477	0.445	Q8N264.pdb.gz	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
3	AFDB:Q9P227	0.273	0.130	2.398E-20	1491	0.189	0.089	Q9P227.pdb.gz	RHG23_HUMAN Rho GTPase-activating protein 23 OS=Homo sapiens OX=9606 GN=ARHGAP23 PE=1 SV=2
4	AFDB:B2RQE8	0.260	0.218	3.220E-18	841	0.182	0.151	B2RQE8.pdb.gz	RHG42_MOUSE Rho GTPase-activating protein 42 OS=Mus musculus OX=10090 GN=Arhgap42 PE=1 SV=1
5	AFDB:X2JDY8	0.243	0.168	2.358E-16	1025	0.185	0.126	X2JDY8.pdb.gz	RHGF_DROME Rho GTPase-activating protein Graf OS=Drosophila melanogaster OX=7227 GN=Graf PE=1 SV=1
6	AFDB:D3ZFJ3	0.263	0.267	4.883E-15	689	0.155	0.157	D3ZFJ3.pdb.gz	3BP1_RAT SH3 domain-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Sh3bp1 PE=1 SV=1
7	AFDB:Q9Y3L3	0.264	0.263	6.954E-15	701	0.162	0.161	Q9Y3L3.pdb.gz	3BP1_HUMAN SH3 domain-binding protein 1 OS=Homo sapiens OX=9606 GN=SH3BP1 PE=1 SV=3
8	AFDB:Q68EM7	0.272	0.217	1.726E-14	881	0.168	0.133	Q68EM7.pdb.gz	RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1
9	PDB:6r3vA	0.267	0.910	1.101E-13	198	0.085	0.298	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
10	AFDB:Q19370	0.267	0.179	1.515E-13	1059	0.179	0.118	Q19370.pdb.gz	Q19370_CAEEL Rho-GAP domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=srgp-1 PE=1 SV=2
11	AFDB:Q8CGF1	0.278	0.158	1.676E-13	1266	0.138	0.076	Q8CGF1.pdb.gz	RHG29_MOUSE Rho GTPase-activating protein 29 OS=Mus musculus OX=10090 GN=Arhgap29 PE=1 SV=1
12	PDB:3cxlA	0.265	0.450	2.400E-12	402	0.082	0.142	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	PDB:1xa6A	0.271	0.465	1.721E-11	399	0.082	0.143	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
14	PDB:5c2kA	0.252	0.450	2.002E-11	382	0.103	0.188	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
15	PDB:5jcpA	0.229	0.435	1.927E-8	361	0.062	0.119	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
16	PDB:6bbpA	0.139	0.185	6.615E-7	520	0.062	0.083	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
17	PDB:3ljuX	0.128	0.235	7.105E-6	373	0.034	0.064	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
18	PDB:6u3eA	0.127	0.221	1.012E-5	397	0.042	0.073	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
19	PDB:6hhgA	0.121	0.212	5.928E-5	386	0.036	0.065	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
20	PDB:4uudC	0.127	0.630	1.087E-4	113	0.040	0.248	4uudC.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z5H3	0.0	1420	698	1.000	1.000	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
2	Q8C4V1	0.0	589	747	0.499	0.466	RHG24_MOUSE Rho GTPase-activating protein 24 OS=Mus musculus OX=10090 GN=Arhgap24 PE=1 SV=2
3	Q8N264	0.0	597	748	0.493	0.460	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
4	P42331	1.27e-151	456	645	0.415	0.450	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
5	Q17R89	5.39e-29	125	818	0.105	0.089	RHG44_HUMAN Rho GTPase-activating protein 44 OS=Homo sapiens OX=9606 GN=ARHGAP44 PE=1 SV=1
6	Q91Z69	1.12e-28	125	1062	0.109	0.072	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
7	F1LQX4	1.13e-28	124	814	0.105	0.090	RHG44_RAT Rho GTPase-activating protein 44 OS=Rattus norvegicus OX=10116 GN=Arhgap44 PE=1 SV=2
8	O43295	1.46e-28	124	1099	0.120	0.076	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
9	Q5SSM3	2.37e-28	124	814	0.103	0.088	RHG44_MOUSE Rho GTPase-activating protein 44 OS=Mus musculus OX=10090 GN=Arhgap44 PE=1 SV=1
10	Q7Z6B7	5.73e-28	123	1085	0.107	0.069	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
11	Q68EM7	1.34e-27	121	881	0.105	0.083	RHG17_HUMAN Rho GTPase-activating protein 17 OS=Homo sapiens OX=9606 GN=ARHGAP17 PE=1 SV=1
12	Q54DW4	1.87e-27	121	1350	0.103	0.053	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
13	Q812A2	3.86e-27	120	1099	0.103	0.066	SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Srgap3 PE=1 SV=1
14	Q99N37	9.93e-27	119	858	0.103	0.084	RHG17_RAT Rho GTPase-activating protein 17 OS=Rattus norvegicus OX=10116 GN=Arhgap17 PE=1 SV=1
15	Q3UIA2	1.04e-26	118	846	0.103	0.085	RHG17_MOUSE Rho GTPase-activating protein 17 OS=Mus musculus OX=10090 GN=Arhgap17 PE=1 SV=1
16	Q5VZB4	2.14e-26	115	450	0.095	0.147	Q5VZB4_HUMAN SLIT-ROBO Rho GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
17	Q6TLK4	5.32e-26	116	869	0.092	0.074	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
18	Q6ZUM4	7.88e-26	115	889	0.096	0.075	RHG27_HUMAN Rho GTPase-activating protein 27 OS=Homo sapiens OX=9606 GN=ARHGAP27 PE=1 SV=3
19	B7ZM87	1.03e-25	115	1070	0.095	0.062	B7ZM87_HUMAN SLIT-ROBO Rho GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
20	O75044	1.04e-25	115	1071	0.095	0.062	SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	3.8e+02	12.6	Afadin- and alpha -actinin-Binding
2	PF08614 ATG16	0.37	22.5	Autophagy protein 16 (ATG16)
3	PF14932 HAUS-augmin3	1e+02	13.8	HAUS augmin-like complex subunit 3
4	PF00169 PH	4.6e-19	80.2	PH domain
5	PF15413 PH_11	0.014	27.2	Pleckstrin homology domain
6	PF20399 PH_20	0.38	22.2	PH domain
7	PF14593 PH_3	39	15.7	PH domain
8	PF15409 PH_8	2.4	19.8	Pleckstrin homology domain
9	PF00620 RhoGAP	9.8e-43	157.0	RhoGAP domain
10	PF12718 Tropomyosin_1	12	17.5	Tropomyosin like

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000412461

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000368278	0.806	Interleukin-1 receptor accessory protein-like 1
2	9606.ENSP00000462337	0.745	Vascular endothelial zinc finger 1
3	9606.ENSP00000266037	0.695	Dedicator of cytokinesis protein 3
4	9606.ENSP00000234313	0.614	Pleckstrin
5	9606.ENSP00000323435	0.600	Sorting nexin-22
6	9606.ENSP00000355511	0.594	Rab proteins geranylgeranyltransferase component A 2
7	9606.ENSP00000363317	0.594	FERM and PDZ domain-containing protein 2
8	9606.ENSP00000358866	0.590	Filamin-A
9	9606.ENSP00000483313	0.570	Wiskott-Aldrich syndrome protein family member 2
10	9606.ENSP00000215531	0.559	Small integral membrane protein 24
11	9606.ENSP00000320563	0.553	WD repeat- and FYVE domain-containing protein 4
12	9606.ENSP00000377941	0.549	Alpha-actinin-1
13	9606.ENSP00000371994	0.536	Protein NYNRIN
14	9606.ENSP00000258390	0.521	Dedicator of cytokinesis protein 10
15	9606.ENSP00000406026	0.512	SH2 domain-containing protein 5
16	9606.ENSP00000366460	0.501	Plexin domain-containing protein 2
17	9606.ENSP00000400175	0.501	Transforming protein RhoA

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity
GO:0019899	0.495	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0051056	0.977	regulation of small GTPase mediated signal transduction
GO:0051128	0.839	regulation of cellular component organization
GO:0009987	0.801	cellular process
GO:0065008	0.737	regulation of biological quality
GO:0050807	0.649	regulation of synapse organization
GO:0099175	0.640	regulation of postsynapse organization
GO:0050896	0.552	response to stimulus
GO:0051716	0.512	cellular response to stimulus
GO:0007165	0.498	signal transduction
GO:0016043	0.306	cellular component organization

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0030054	0.981	cell junction
GO:0070161	0.966	anchoring junction
GO:0030055	0.911	cell-substrate junction
GO:0005925	0.899	focal adhesion
GO:0016020	0.863	membrane
GO:0043226	0.800	organelle
GO:0043229	0.734	intracellular organelle
GO:0045202	0.694	synapse
GO:0098978	0.677	glutamatergic synapse
GO:0071944	0.397	cell periphery
GO:0043231	0.383	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]