StarFunc result for job id Q7Z5J4

User Input

>input (1906 residues)
MQSFRERCGFHGKQQNYQQTSQETSRLENYRQPSQAGLSCDRQRLLAKDYYNPQPYPSYE
GGAGTPSGTAAAVAADKYHRGSKALPTQQGLQGRPAFPGYGVQDSSPYPGRYAGEESLQA
WGAPQPPPPQPQPLPAGVAKYDENLMKKTAVPPSRQYAEQGAQVPFRTHSLHVQQPPPPQ
QPLAYPKLQRQKLQNDIASPLPFPQGTHFPQHSQSFPTSSTYSSSVQGGGQGAHSYKSCT
APTAQPHDRPLTASSSLAPGQRVQNLHAYQSGRLSYDQQQQQQQQQQQQQQALQSRHHAQ
ETLHYQNLAKYQHYGQQGQGYCQPDAAVRTPEQYYQTFSPSSSHSPARSVGRSPSYSSTP
SPLMPNLENFPYSQQPLSTGAFPAGITDHSHFMPLLNPSPTDATSSVDTQAGNCKPLQKD
KLPENLLSDLSLQSLTALTSQVENISNTVQQLLLSKAAVPQKKGVKNLVSRTPEQHKSQH
CSPEGSGYSAEPAGTPLSEPPSSTPQSTHAEPQEADYLSGSEDPLERSFLYCNQARGSPA
RVNSNSKAKPESVSTCSVTSPDDMSTKSDDSFQSLHGSLPLDSFSKFVAGERDCPRLLLS
ALAQEDLASEILGLQEAIGEKADKAWAEAPSLVKDSSKPPFSLENHSACLDSVAKSAWPR
PGEPEALPDSLQLDKGGNAKDFSPGLFEDPSVAFATPDPKKTTGPLSFGTKPTLGVPAPD
PTTAAFDCFPDTTAASSADSANPFAWPEENLGDACPRWGLHPGELTKGLEQGGKASDGIS
KGDTHEASACLGFQEEDPPGEKVASLPGDFKQEEVGGVKEEAGGLLQCPEVAKADRWLED
SRHCCSTADFGDLPLLPPTSRKEDLEAEEEYSSLCELLGSPEQRPGMQDPLSPKAPLICT
KEEVEEVLDSKAGWGSPCHLSGESVILLGPTVGTESKVQSWFESSLSHMKPGEEGPDGER
APGDSTTSDASLAQKPNKPAVPEAPIAKKEPVPRGKSLRSRRVHRGLPEAEDSPCRAPVL
PKDLLLPESCTGPPQGQMEGAGAPGRGASEGLPRMCTRSLTALSEPRTPGPPGLTTTPAP
PDKLGGKQRAAFKSGKRVGKPSPKAASSPSNPAALPVASDSSPMGSKTKETDSPSTPGKD
QRSMILRSRTKTQEIFHSKRRRPSEGRLPNCRATKKLLDNSHLPATFKVSSSPQKEGRVS
QRARVPKPGAGSKLSDRPLHALKRKSAFMAPVPTKKRNLVLRSRSSSSSNASGNGGDGKE
ERPEGSPTLFKRMSSPKKAKPTKGNGEPATKLPPPETPDACLKLASRAAFQGAMKTKVLP
PRKGRGLKLEAIVQKITSPSLKKFACKAPGASPGNPLSPSLSDKDRGLKGAGGSPVGVEE
GLVNVGTGQKLPTSGADPLCRNPTNRSLKGKLMNSKKLSSTDCFKTEAFTSPEALQPGGT
ALAPKKRSRKGRAGAHGLSKGPLEKRPYLGPALLLTPRDRASGTQGASEDNSGGGGKKPK
MEELGLASQPPEGRPCQPQTRAQKQPGHTNYSSYSKRKRLTRGRAKNTTSSPCKGRAKRR
RQQQVLPLDPAEPEIRLKYISSCKRLRSDSRTPAFSPFVRVEKRDAFTTICTVVNSPGDA
PKPHRKPSSSASSSSSSSSFSLDAAGASLATLPGGSILQPRPSLPLSSTMHLGPVVSKAL
STSCLVCCLCQNPANFKDLGDLCGPYYPEHCLPKKKPKLKEKVRPEGTCEEASLPLERTL
KGPECAAAATAGKPPRPDGPADPAKQGPLRTSARGLSRRLQSCYCCDGREDGGEEAAPAD
KGRKHECSKEAPAEPGGEAQEHWVHEACAVWTGGVYLVAGKLFGLQEAMKVAVDMMCSSC
QEAGATIGCCHKGCLHTYHYPCASDAGCIFIEENFSLKCPKHKRLP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q61818	0.148	0.148	0.000	1889	0.824	0.832	Q61818.pdb.gz	RAI1_MOUSE Retinoic acid-induced protein 1 OS=Mus musculus OX=10090 GN=Rai1 PE=1 SV=3
2	AFDB:Q7Z5J4	1.000	1.000	0.000	1906	1.000	1.000	Q7Z5J4.pdb.gz	RAI1_HUMAN Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1 PE=1 SV=2
3	AFDB:Q9UGU0	0.076	0.075	3.040E-42	1960	0.246	0.239	Q9UGU0.pdb.gz	TCF20_HUMAN Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20 PE=1 SV=3
4	AFDB:Q9EPQ8	0.085	0.082	1.568E-40	1987	0.250	0.240	Q9EPQ8.pdb.gz	TCF20_MOUSE Transcription factor 20 OS=Mus musculus OX=10090 GN=Tcf20 PE=1 SV=3
5	AFDB:Q8IRW8	0.047	0.038	2.156E-13	2431	0.167	0.131	Q8IRW8.pdb.gz	TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster OX=7227 GN=trr PE=1 SV=2
6	AFDB:Q9W2S5	0.030	0.027	1.303E-3	2139	0.153	0.136	Q9W2S5.pdb.gz	Q9W2S5_DROME X11Lbeta, isoform A OS=Drosophila melanogaster OX=7227 GN=X11Lbeta PE=1 SV=5
7	AFDB:P97868	0.028	0.030	1.393E-3	1790	0.126	0.134	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
8	AFDB:P10070	0.026	0.033	3.551E-3	1586	0.135	0.162	P10070.pdb.gz	GLI2_HUMAN Zinc finger protein GLI2 OS=Homo sapiens OX=9606 GN=GLI2 PE=1 SV=4
9	AFDB:Q7Z6E9	0.028	0.029	7.406E-3	1792	0.127	0.136	Q7Z6E9.pdb.gz	RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1
10	AFDB:Q96L73	0.031	0.024	9.051E-3	2696	0.160	0.113	Q96L73.pdb.gz	NSD1_HUMAN Histone-lysine N-methyltransferase, H3 lysine-36 specific OS=Homo sapiens OX=9606 GN=NSD1 PE=1 SV=1
11	PDB:4kfzB	0.026	0.172	1.982E-1	148	0.013	0.162	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
12	PDB:2lgvA	0.025	0.161	2.198	100	0.012	0.220	2lgvA.pdb.gz	Selective recruitment of an e2~ubiquitin complex by an e3 ubiquitin ligase.
13	PDB:4wa6D	0.022	0.083	2.350	415	0.008	0.039	4wa6D.pdb.gz	Structure of yeast SAGA DUBm with Sgf73 N59D mutant at 2.36 angstroms resolution
14	PDB:3k1lA	0.016	0.075	4.902	376	0.004	0.019	3k1lA.pdb.gz	The structure of the catalytic subunit FANCL of the Fanconi anemia core complex
15	PDB:6drtA	0.013	0.073	5.602	230	0.005	0.043	6drtA.pdb.gz	T4 DNA ligase structure reveals a prototypical ATP-dependent ligase with a unique mode of sliding clamp interaction.
16	PDB:5a31B	0.014	0.250	8.366	84	0.007	0.155	5a31B.pdb.gz	Atomic Structure of the Apc/C and its Mechanism of Protein Ubiquitination.
17	PDB:7ajuCK	0.020	0.115	8.944	222	0.009	0.077	7ajuCK.pdb.gz	Structure of the Maturing 90S Pre-ribosome in Association with the RNA Exosome.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A8MXE8	0.0	1919	942	0.494	1.000	A8MXE8_HUMAN Retinoic acid induced 1 (Fragment) OS=Homo sapiens OX=9606 GN=RAI1 PE=1 SV=1
2	Q61818	0.0	2935	1889	0.823	0.831	RAI1_MOUSE Retinoic acid-induced protein 1 OS=Mus musculus OX=10090 GN=Rai1 PE=1 SV=3
3	Q7Z5J4	0.0	3854	1906	1.000	1.000	RAI1_HUMAN Retinoic acid-induced protein 1 OS=Homo sapiens OX=9606 GN=RAI1 PE=1 SV=2
4	Q9EPQ8	6.74e-48	192	1987	0.065	0.062	TCF20_MOUSE Transcription factor 20 OS=Mus musculus OX=10090 GN=Tcf20 PE=1 SV=3
5	Q66JM6	3.35e-47	188	1068	0.065	0.116	Q66JM6_MOUSE Tcf20 protein (Fragment) OS=Mus musculus OX=10090 GN=Tcf20 PE=2 SV=1
6	Q9UGU0	1.75e-17	92.0	1960	0.045	0.043	TCF20_HUMAN Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20 PE=1 SV=3
7	W5ZR30	1.75e-17	92.0	1960	0.045	0.043	W5ZR30_HUMAN Transcription factor 20 OS=Homo sapiens OX=9606 GN=TCF20 PE=2 SV=1
8	Q8IRW8	2.19e-13	78.6	2431	0.021	0.016	TRR_DROME Histone-lysine N-methyltransferase trr OS=Drosophila melanogaster OX=7227 GN=trr PE=1 SV=2
9	A0A8I6A900	5.39e-13	77.4	4946	0.017	0.006	A0A8I6A900_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
10	A0A8I6A825	5.81e-13	77.4	4952	0.017	0.006	A0A8I6A825_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
11	A0A8I6G4C0	5.81e-13	77.4	4986	0.017	0.006	A0A8I6G4C0_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
12	A0A8I6A4Z1	5.86e-13	77.4	5003	0.017	0.006	A0A8I6A4Z1_RAT [histone H3]-lysine(4) N-methyltransferase OS=Rattus norvegicus OX=10116 GN=Kmt2c PE=1 SV=1
13	Q8BRH4	6.16e-13	77.4	4903	0.017	0.007	KMT2C_MOUSE Histone-lysine N-methyltransferase 2C OS=Mus musculus OX=10090 GN=Kmt2c PE=1 SV=2
14	Q8NEZ4	1.15e-12	76.3	4911	0.017	0.007	KMT2C_HUMAN Histone-lysine N-methyltransferase 2C OS=Homo sapiens OX=9606 GN=KMT2C PE=1 SV=3
15	O14686	4.03e-12	74.7	5537	0.018	0.006	KMT2D_HUMAN Histone-lysine N-methyltransferase 2D OS=Homo sapiens OX=9606 GN=KMT2D PE=1 SV=2
16	Q6PDK2	4.81e-12	74.3	5588	0.017	0.006	KMT2D_MOUSE Histone-lysine N-methyltransferase 2D OS=Mus musculus OX=10090 GN=Kmt2d PE=1 SV=2
17	P20659	6.65e-12	73.9	3726	0.023	0.012	TRX_DROME Histone-lysine N-methyltransferase trithorax OS=Drosophila melanogaster OX=7227 GN=trx PE=1 SV=4
18	A8VKP8	2.03e-11	72.4	4218	0.016	0.007	A8VKP8_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
19	F1QL52	2.12e-11	72.4	4219	0.016	0.007	F1QL52_DANRE Histone-lysine N-methyltransferase OS=Danio rerio OX=7955 GN=im:7148357 PE=1 SV=1
20	Q03164	2.83e-11	71.6	3969	0.015	0.007	KMT2A_HUMAN Histone-lysine N-methyltransferase 2A OS=Homo sapiens OX=9606 GN=KMT2A PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF13771 zf-HC5HC2H	1.8e-05	36.2	PHD-like zinc-binding domain
2	PF13832 zf-HC5HC2H_2	0.0029	29.1	PHD-zinc-finger like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000323074

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000308741	0.937	Circadian locomoter output cycles protein kaput
2	9606.ENSP00000352463	0.746	Transcription factor 20
3	9606.ENSP00000369666	0.695	F-box/LRR-repeat protein 19
4	9606.ENSP00000368818	0.578	TOM1-like protein 2
5	9606.ENSP00000244537	0.568	Histone cluster 1 H4 family member f
6	9606.ENSP00000371846	0.523	Deformed epidermal autoregulatory factor 1 homolog
7	9606.ENSP00000371133	0.515	High mobility group protein 20A
8	9606.ENSP00000261692	0.505	Cyclin-dependent kinase 2-associated protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.511	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0060255	0.999	regulation of macromolecule metabolic process
GO:0050794	0.995	regulation of cellular process
GO:0010468	0.982	regulation of gene expression
GO:0019219	0.976	regulation of nucleobase-containing compound metabolic process
GO:0006355	0.963	regulation of DNA-templated transcription
GO:0048518	0.914	positive regulation of biological process
GO:0048522	0.899	positive regulation of cellular process
GO:0010604	0.895	positive regulation of macromolecule metabolic process
GO:1903508	0.892	positive regulation of nucleic acid-templated transcription
GO:0045893	0.884	positive regulation of DNA-templated transcription
GO:0048511	0.825	rhythmic process
GO:0032922	0.762	circadian regulation of gene expression
GO:0048519	0.592	negative regulation of biological process
GO:0009987	0.412	cellular process
GO:0006357	0.399	regulation of transcription by RNA polymerase II
GO:0048523	0.356	negative regulation of cellular process
GO:0008152	0.301	metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0032991	0.862	protein-containing complex
GO:0005737	0.461	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]