StarFunc result for job id Q7Z5J8

User Input

>input (1434 residues)
MLRLPKKGLPRFEQVQDEDTYLENLAIQRNASAFFEKYDRSEIQELLTTALVSWLSAKED
VRSQVDLPCGIMSQMNNVGFSTAILLTPVDPTALLDYREVHQMIRELAIGIYCLNQIPSI
SLEANYDQSSSCQLPPAYYDTRIGQILINIDYMLKALWHGIYMPKEKRARFSELWRAIMD
IDPDGKPQTNKDIFSEFSSAGLTDITKDPDFNEIYDEDVNEDPTYDPNSPEETAVFMKYA
ENIMLKLTFSTTQIQQYENVFIFETGYWLTNAIKYNQDYLDICTYQRLQQRLYLQKKIIQ
KHFEKKKDIRRGIGYLKLICFLIPFLLSLKKKMKVPYLSSLLQPFSDDKVKTERELPPFI
YGRDFKCQNFHYKENQYFHVHGGIEFDISTPSIENALEDFQKNLEKIRDCAANTFIEDSG
YKEYYSIPVMEFHGKSYYVIYFELETFYQQLYKTQWWGAINEIVNNLRLKRLPLTDAQLH
EQFKKKLGFKRAMKCKSIPFGMKSAVERGLSAVFHTFSRKTSSSTINVSDEAGYTIFHHA
ALHNRVSIICQLCNANFKVNQRRFVTFSQGPTPLHLAAQACSLETTVCLLCSKADYTLSE
KRGWMPIHFAAFYDNVCIIIALCRKDPSLLEAEATAENQCTPLLLAATSGALDTIQYLFS
IGANWRKTDIKGNNIIHLSVLTFHTEVLKYIIKLNIPELPVWKTLVEMLQCESYKRRMMA
VMSLEVICLANDQYWRCILDAGTIPALINLLKSSKIKLQCKTVGLLSNISTHKSAVHALV
EAGGIPSLINLLVCDEPEVHSRCAVILYDIAQCENKDVIAKYNGIPSLINLLNLNIENVL
VNVMNCIRVLCIGNENNQRAVREHKGLPYLIRFLSSDSDVLKAVSSAAIAEVGRDNKEIQ
DAIAMEGAIPPLVALFKGKQISVQMKGAMAVESLASHNALIQKAFLEKSLTKYLLKLLKA
FQIDVKEQGAVALWALAGQTLKQQKYMAEQIGYSFIINMLLSPSAKMQYVGGEAVIALSK
DSRMHQNQICEGNGIAPLVRLLRISTIAEGTLLSVIRAVGSICIGVAHTSNPVSQQLVVD
ENAFPVLIQLLRNHPSPNIKVEVAFSLACIVLGNDVLQKDLHENEGFEYADVLYLLHSTE
KDICLRAGYALTLFAFNNRFQQYLILESGIMTISIFERFLESTVETEKAMAAFQIVVLAK
VIRDMDHITLSARGVTILVDSLYSVQTSTIVLTGNLIASLAHSRAGIPEAFTTLGTIQRL
CYHLYSGIEEVRAACSSALGYLTYNANAFRILLKECRNKPNQFIRIKNNISRDASINPAF
LKEFQMQQTLVGLPSLSLEKNGGPSIIPIFKRGKEHRRKLKPKIQPKDSLTLLPPVTNFM
GLFKATKKTKDSHNIFSFSSTITSDITNVSRPRIVCLNQLGKHVQKANPEPAEG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:E1B8W3	0.345	0.461	1.863E-16	1044	0.083	0.114	E1B8W3.pdb.gz	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
2	AFDB:B2RY50	0.344	0.463	8.132E-16	1037	0.081	0.112	B2RY50.pdb.gz	ODAD2_MOUSE Outer dynein arm-docking complex subunit 2 OS=Mus musculus OX=10090 GN=Odad2 PE=1 SV=1
3	AFDB:E7FB07	0.348	0.464	1.413E-15	1047	0.084	0.116	E7FB07.pdb.gz	E7FB07_DANRE Armadillo repeat containing 4 OS=Danio rerio OX=7955 GN=armc4 PE=1 SV=1
4	AFDB:Q5T2S8	0.340	0.454	3.684E-15	1044	0.082	0.113	Q5T2S8.pdb.gz	ODAD2_HUMAN Outer dynein arm-docking complex subunit 2 OS=Homo sapiens OX=9606 GN=ODAD2 PE=1 SV=1
5	PDB:7rroH7	0.295	0.633	6.493E-15	580	0.091	0.226	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
6	AFDB:Q9VM21	0.331	0.648	6.643E-15	669	0.069	0.148	Q9VM21.pdb.gz	GUDU_DROME Armadillo repeat-containing protein gudu OS=Drosophila melanogaster OX=7227 GN=gudu PE=2 SV=1
7	AFDB:Q5W041	0.294	0.469	6.892E-15	872	0.082	0.134	Q5W041.pdb.gz	ARMC3_HUMAN Armadillo repeat-containing protein 3 OS=Homo sapiens OX=9606 GN=ARMC3 PE=2 SV=2
8	AFDB:P14923	0.244	0.402	1.198E-14	745	0.084	0.161	P14923.pdb.gz	PLAK_HUMAN Junction plakoglobin OS=Homo sapiens OX=9606 GN=JUP PE=1 SV=3
9	AFDB:A0A2R8Y750	0.237	0.384	2.796E-14	744	0.081	0.156	A0A2R8Y750.pdb.gz	A0A2R8Y750_HUMAN Catenin beta 1 OS=Homo sapiens OX=9606 GN=CTNNB1 PE=1 SV=1
10	AFDB:B9DHT4	0.241	0.463	4.858E-14	710	0.086	0.175	B9DHT4.pdb.gz	ARIA_ARATH ARM REPEAT PROTEIN INTERACTING WITH ABF2 OS=Arabidopsis thaliana OX=3702 GN=ARIA PE=1 SV=2
11	AFDB:Q9M224	0.227	0.322	1.831E-13	928	0.088	0.136	Q9M224.pdb.gz	ADLO2_ARATH Protein ARABIDILLO 2 OS=Arabidopsis thaliana OX=3702 GN=At3g60350 PE=2 SV=1
12	PDB:2z6gA	0.239	0.482	9.053E-13	550	0.073	0.189	2z6gA.pdb.gz
13	PDB:7nscE	0.308	0.630	2.450E-10	615	0.061	0.141	7nscE.pdb.gz
14	PDB:6kbnC	0.256	0.632	2.638E-10	504	0.067	0.190	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
15	PDB:3tpoA	0.226	0.612	4.756E-10	438	0.045	0.148	3tpoA.pdb.gz
16	PDB:5tbkA	0.243	0.757	6.386E-10	417	0.048	0.165	5tbkA.pdb.gz
17	PDB:1wa5B	0.237	0.638	9.578E-10	466	0.045	0.139	1wa5B.pdb.gz	Structural basis for the assembly of a nuclear export complex.
18	PDB:4r0zA	0.259	0.555	1.334E-9	557	0.060	0.154	4r0zA.pdb.gz
19	PDB:4jlqA	0.222	0.333	4.671E-9	840	0.091	0.156	4jlqA.pdb.gz	Crystal structure of human Karyopherin beta 2 bound to the PY-NLS of Saccharomyces cerevisiae Nab2.
20	PDB:4tnmA	0.195	0.556	8.118E-9	407	0.050	0.174	4tnmA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	B2RY50	3.01e-19	97.1	1037	0.084	0.116	ODAD2_MOUSE Outer dynein arm-docking complex subunit 2 OS=Mus musculus OX=10090 GN=Odad2 PE=1 SV=1
2	Q5T2S8	5.83e-14	79.7	1044	0.080	0.110	ODAD2_HUMAN Outer dynein arm-docking complex subunit 2 OS=Homo sapiens OX=9606 GN=ODAD2 PE=1 SV=1
3	E1B8W3	1.39e-12	75.1	1044	0.080	0.110	ODAD2_BOVIN Outer dynein arm-docking complex subunit 2 OS=Bos taurus OX=9913 GN=ODAD2 PE=1 SV=3
4	Q8GUG9	1.95e-12	74.3	612	0.044	0.103	PUB11_ARATH U-box domain-containing protein 11 OS=Arabidopsis thaliana OX=3702 GN=PUB11 PE=2 SV=2
5	E7FB07	5.13e-12	73.6	1047	0.078	0.107	E7FB07_DANRE Armadillo repeat containing 4 OS=Danio rerio OX=7955 GN=armc4 PE=1 SV=1
6	B7U179	1.58e-11	71.6	737	0.068	0.133	ABAP1_ARATH ARMADILLO BTB ARABIDOPSIS PROTEIN 1 OS=Arabidopsis thaliana OX=3702 GN=ABAP1 PE=1 SV=1
7	G5E8K5	1.73e-11	72.0	1961	0.034	0.025	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
8	A0A0G2K6R9	3.07e-11	71.2	3998	0.034	0.012	A0A0G2K6R9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
9	A0A0G2KAS9	3.20e-11	71.2	3980	0.034	0.012	A0A0G2KAS9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
10	A0A0G2JZ56	3.31e-11	71.2	4013	0.034	0.012	A0A0G2JZ56_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
11	F1M9N9	3.69e-11	70.9	3977	0.034	0.012	F1M9N9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
12	F1LM42	3.89e-11	70.9	4021	0.034	0.012	F1LM42_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
13	P97582	3.97e-11	70.5	843	0.034	0.058	P97582_RAT Ankyrin (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
14	Q8C8R3	3.98e-11	70.9	3898	0.034	0.013	ANK2_MOUSE Ankyrin-2 OS=Mus musculus OX=10090 GN=Ank2 PE=1 SV=2
15	A0A0G2KBB9	4.06e-11	70.9	4017	0.034	0.012	A0A0G2KBB9_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=2
16	O88521	5.15e-11	70.5	1762	0.035	0.028	O88521_RAT 190 kDa ankyrin isoform OS=Rattus norvegicus OX=10116 PE=2 SV=1
17	O70511	5.17e-11	70.5	2622	0.033	0.018	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
18	Q12955	5.34e-11	70.5	4377	0.033	0.011	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
19	Q5VRH9	5.59e-11	69.7	611	0.045	0.105	PUB12_ORYSJ U-box domain-containing protein 12 OS=Oryza sativa subsp. japonica OX=39947 GN=PUB12 PE=2 SV=1
20	Q9ERK0	6.15e-11	69.7	786	0.040	0.074	RIPK4_MOUSE Receptor-interacting serine/threonine-protein kinase 4 OS=Mus musculus OX=10090 GN=Ripk4 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	21	17.0	Ankyrin repeat
2	PF12796 Ank_2	1.8e-10	52.5	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	6.2e-09	46.2	Ankyrin repeat
4	PF13637 Ank_4	7.4e-10	50.4	Ankyrin repeats (many copies)
5	PF13857 Ank_5	0.00025	32.5	Ankyrin repeats (many copies)
6	PF00514 Arm	1.1e-24	96.9	Armadillo/beta-catenin-like repeat
7	PF09759 Atx10homo_assoc	12	17.3	Spinocerebellar ataxia type 10 protein domain
8	PF02985 HEAT	76	15.0	HEAT repeat
9	PF13646 HEAT_2	0.0001	33.9	HEAT repeats
10	PF13513 HEAT_EZ	1.7	20.6	HEAT-like repeat

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000427882

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000264151	0.910	Probable tRNA N6-adenosine threonylcarbamoyltransferase, mitochondrial
2	9606.ENSP00000381567	0.818	TATA element modulatory factor
3	9606.ENSP00000307860	0.660	Disrupted in renal carcinoma 1
4	9606.ENSP00000386292	0.653	Nuclear envelope integral membrane protein 2
5	9606.ENSP00000326869	0.650	ORM1-like protein 1
6	9606.ENSP00000260952	0.571	Asparagine synthetase domain containing 1
7	9606.ENSP00000410186	0.569	Adenylate kinase 9
8	9606.ENSP00000345107	0.556	Small membrane A-kinase anchor protein
9	9606.ENSP00000314193	0.528	WD repeat-containing protein 75
10	9606.ENSP00000376141	0.517	Major facilitator superfamily domain containing 6
11	9606.ENSP00000320794	0.515	Basic helix-loop-helix domain-containing protein USF3
12	9606.ENSP00000380517	0.513	Cadherin-24

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.506	enzyme binding
GO:0003824	0.349	catalytic activity
GO:1901363	0.323	heterocyclic compound binding
GO:0097159	0.322	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.987	cellular process
GO:0065007	0.906	biological regulation
GO:0050789	0.861	regulation of biological process
GO:0050794	0.838	regulation of cellular process
GO:0008152	0.554	metabolic process
GO:0044237	0.440	cellular metabolic process
GO:0019222	0.408	regulation of metabolic process
GO:0071704	0.372	organic substance metabolic process
GO:0031323	0.370	regulation of cellular metabolic process
GO:0050896	0.346	response to stimulus
GO:0060255	0.321	regulation of macromolecule metabolic process
GO:0044238	0.317	primary metabolic process
GO:0080090	0.313	regulation of primary metabolic process
GO:0051171	0.306	regulation of nitrogen compound metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043227	0.998	membrane-bounded organelle
GO:0043229	0.998	intracellular organelle
GO:0043231	0.983	intracellular membrane-bounded organelle
GO:0005737	0.969	cytoplasm
GO:0016020	0.597	membrane
GO:0005634	0.553	nucleus
GO:0043233	0.405	organelle lumen
GO:0070013	0.390	intracellular organelle lumen
GO:0005829	0.360	cytosol
GO:0043232	0.327	intracellular non-membrane-bounded organelle
GO:0005856	0.304	cytoskeleton

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]