StarFunc result for job id Q7Z5K2

User Input

>input (1190 residues)
MTSRFGKTYSRKGGNGSSKFDEVFSNKRTTLSTKWGETTFMAKLGQKRPNFKPDIQEIPK
KPKVEEESTGDPFGFDSDDESLPVSSKNLAQVKCSSYSESSEAAQLEEVTSVLEANSKIS
HVVVEDTVVSDKCFPLEDTLLGKEKSTNRIVEDDASISSCNKLITSDKVENFHEEHEKNS
HHIHKNADDSTKKPNAETTVASEIKETNDTWNSQFGKRPESPSEISPIKGSVRTGLFEWD
NDFEDIRSEDCILSLDSDPLLEMKDDDFKNRLENLNEAIEEDIVQSVLRPTNCRTYCRAN
KTKSSQGASNFDKLMDGTSQALAKANSESSKDGLNQAKKGGVSCGTSFRGTVGRTRDYTV
LHPSCLSVCNVTIQDTMERSMDEFTASTPADLGEAGRLRKKADIATSKTTTRFRPSNTKS
KKDVKLEFFGFEDHETGGDEGGSGSSNYKIKYFGFDDLSESEDDEDDDCQVERKTSKKRT
KTAPSPSLQPPPESNDNSQDSQSGTNNAENLDFTEDLPGVPESVKKPINKQGDKSKENTR
KIFSGPKRSPTKAVYNARHWNHPDSEELPGPPVVKPQSVTVRLSSKEPNQKDDGVFKAPA
PPSKVIKTVTIPTQPYQDIVTALKCRREDKELYTVVQHVKHFNDVVEFGENQEFTDDIEY
LLSGLKSTQPLNTRCLSVISLATKCAMPSFRMHLRAHGMVAMVFKTLDDSQHHQNLSLCT
AALMYILSRDRLNMDLDRASLDLMIRLLELEQDASSAKLLNEKDMNKIKEKIRRLCETVH
NKHLDLENITTGHLAMETLLSLTSKRAGDWFKEELRLLGGLDHIVDKVKECVDHLSRDED
EEKLVASLWGAERCLRVLESVTVHNPENQSYLIAYKDSQLIVSSAKALQHCEELIQQYNR
AEDSICLADSKPLPHQNVTNHVGKAVEDCMRAIIGVLLNLTNDNEWGSTKTGEQDGLIGT
ALNCVLQVPKYLPQEQRFDIRVLGLGLLINLVEYSARNRHCLVNMETSCSFDSSICSGEG
DDSLRIGGQVHAVQALVQLFLERERAAQLAESKTDELIKDAPTTQHDKSGEWQETSGEIQ
WVSTEKTDGTEEKHKKEEEDEELDLNKALQHAGKHMEDCIVASYTALLLGCLCQESPINV
TTVREYLPEGDFSIMTEMLKKFLSFMNLTCAVGTTGQKSISRVIEYLEHC

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z5K2	1.000	1.000	0.000	1190	1.000	1.000	Q7Z5K2.pdb.gz	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
2	AFDB:F4K0Y5	0.078	0.079	5.567E-5	1165	0.133	0.136	F4K0Y5.pdb.gz	F4K0Y5_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR16 PE=1 SV=1
3	PDB:4hm9A	0.236	0.471	6.066E-5	511	0.059	0.137	4hm9A.pdb.gz
4	AFDB:F4IKX0	0.073	0.076	1.200E-4	1108	0.123	0.132	F4IKX0.pdb.gz	F4IKX0_ARATH Heat shock protein DnaJ with tetratricopeptide repeat-containing protein OS=Arabidopsis thaliana OX=3702 GN=TPR15 PE=1 SV=1
5	PDB:2z6gA	0.099	0.166	1.256E-4	550	0.063	0.136	2z6gA.pdb.gz
6	AFDB:A0A0R4IZ84	0.087	0.072	1.873E-4	1544	0.118	0.091	A0A0R4IZ84.pdb.gz	EST1A_DANRE Telomerase-binding protein EST1A OS=Danio rerio OX=7955 GN=smg6 PE=2 SV=1
7	AFDB:E5FYH1	0.076	0.062	2.115E-4	1653	0.142	0.102	E5FYH1.pdb.gz	TOPZ1_MOUSE Protein TOPAZ1 OS=Mus musculus OX=10090 GN=Topaz1 PE=2 SV=1
8	PDB:7rroH7	0.129	0.208	5.387E-4	580	0.062	0.128	7rroH7.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
9	AFDB:P25339	0.072	0.083	5.812E-4	888	0.102	0.136	P25339.pdb.gz	PUF4_YEAST Pumilio homology domain family member 4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=PUF4 PE=1 SV=2
10	AFDB:Q9P789	0.064	0.069	9.068E-4	1065	0.127	0.142	Q9P789.pdb.gz	YN8E_SCHPO Pumilio domain-containing protein P35G2.14 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP35G2.14 PE=1 SV=2
11	AFDB:A0A0R4IWL6	0.092	0.093	1.110E-3	1152	0.122	0.126	A0A0R4IWL6.pdb.gz	A0A0R4IWL6_DANRE Pumilio RNA-binding family member 1 OS=Danio rerio OX=7955 GN=fb96a03 PE=1 SV=2
12	AFDB:P25822	0.079	0.069	1.415E-3	1533	0.108	0.084	P25822.pdb.gz	PUM_DROME Maternal protein pumilio OS=Drosophila melanogaster OX=7227 GN=pum PE=1 SV=2
13	AFDB:Q0KK59	0.098	0.065	1.415E-3	2596	0.142	0.065	Q0KK59.pdb.gz	UNC79_MOUSE Protein unc-79 homolog OS=Mus musculus OX=10090 GN=Unc79 PE=1 SV=1
14	PDB:5voxP	0.107	0.204	2.716E-3	462	0.047	0.121	5voxP.pdb.gz
15	PDB:6kbnC	0.121	0.221	3.066E-3	504	0.062	0.147	6kbnC.pdb.gz	Quaternary structures of Vac8 differentially regulate the Cvt and PMN pathways.
16	PDB:7q2xD	0.076	0.087	4.412E-3	994	0.072	0.087	7q2xD.pdb.gz	Clamping of DNA shuts the condensin neck gate.
17	PDB:3nd2A	0.110	0.126	5.401E-3	861	0.046	0.064	3nd2A.pdb.gz
18	PDB:7jq9A	0.177	0.104	5.401E-3	2427	0.062	0.030	7jq9A.pdb.gz
19	PDB:3opbA	0.172	0.239	6.098E-3	747	0.058	0.092	3opbA.pdb.gz
20	PDB:7wug5	0.135	0.180	6.884E-3	782	0.055	0.083	7wug5.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z5K2	0.0	2468	1190	1.000	1.000	WAPL_HUMAN Wings apart-like protein homolog OS=Homo sapiens OX=9606 GN=WAPL PE=1 SV=1
2	Q9W517	1.30e-91	327	1741	0.173	0.118	WAPL_DROME Protein wings apart-like OS=Drosophila melanogaster OX=7227 GN=wapl PE=1 SV=1
3	H2L0H5	2.05e-55	209	748	0.136	0.217	WAPL_CAEEL Wings apart-like protein homolog 1 OS=Caenorhabditis elegans OX=6239 GN=wapl-1 PE=3 SV=1
4	F4I7C7	1.94e-10	67.8	930	0.066	0.085	WAPL1_ARATH Wings apart-like protein 1 OS=Arabidopsis thaliana OX=3702 GN=WAPL1 PE=2 SV=1
5	Q9C951	9.60e-08	58.9	840	0.065	0.092	WAPL2_ARATH Wings apart-like protein 2 OS=Arabidopsis thaliana OX=3702 GN=WAPL2 PE=2 SV=1
6	O96971	1.0	35.8	555	0.017	0.036	O96971_9TRYP Polyadenylate-binding protein OS=Trypanosoma brucei OX=5691 PE=2 SV=1
7	Q2V2M9	1.0	36.2	1422	0.033	0.027	FHOD3_HUMAN FH1/FH2 domain-containing protein 3 OS=Homo sapiens OX=9606 GN=FHOD3 PE=1 SV=2
8	Q38DU2	1.0	35.8	555	0.017	0.036	Q38DU2_TRYB2 Polyadenylate-binding protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb09.211.2150 PE=3 SV=1
9	Q9VWI2	1.1	35.8	890	0.020	0.027	Q9VWI2_DROME N(Alpha)-acetyltransferase 15/16, isoform A OS=Drosophila melanogaster OX=7227 GN=Naa15-16 PE=1 SV=1
10	O94364	1.2	35.8	602	0.026	0.051	WAPL_SCHPO Wings apart-like protein homolog 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=wpl1 PE=3 SV=1
11	Q9MC15	1.7	35.4	636	0.024	0.046	Q9MC15_9VIRU RNA-directed RNA polymerase OS=Pseudomonas phage phi8 OX=120086 GN=2 PE=4 SV=1
12	Q76LL6	2.1	35.0	1578	0.031	0.023	FHOD3_MOUSE FH1/FH2 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Fhod3 PE=1 SV=1
13	F1LQJ2	2.8	34.7	1578	0.031	0.023	F1LQJ2_RAT Formin homology 2 domain containing 3 OS=Rattus norvegicus OX=10116 GN=Fhod3 PE=4 SV=4
14	Q9QZC2	3.9	34.3	1574	0.023	0.017	PLXC1_MOUSE Plexin-C1 OS=Mus musculus OX=10090 GN=Plxnc1 PE=1 SV=1
15	R4I4W0	8.9	32.3	235	0.018	0.094	R4I4W0_TAEGU Adrenergic receptor alpha 2a (Fragment) OS=Taeniopygia guttata OX=59729 GN=ADRA2A PE=2 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07814 WAPL	9.8e-113	388.2	Wings apart-like protein regulation of heterochromatin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000298767

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000303427	0.999	Sister chromatid cohesion protein PDS5 homolog A
2	9606.ENSP00000313851	0.999	Sister chromatid cohesion protein PDS5 homolog B
3	9606.ENSP00000354720	0.998	Structural maintenance of chromosomes protein 3
4	9606.ENSP00000297338	0.997	Double-strand-break repair protein rad21 homolog
5	9606.ENSP00000372689	0.992	Cohesin subunit SA-1
6	9606.ENSP00000218089	0.990	Cohesin subunit SA-2
7	9606.ENSP00000269214	0.989	N-acetyltransferase ESCO1
8	9606.ENSP00000275517	0.989	Sororin
9	9606.ENSP00000323421	0.988	Structural maintenance of chromosomes protein 1A
10	9606.ENSP00000306999	0.987	N-acetyltransferase ESCO2
11	9606.ENSP00000282516	0.973	Nipped-B-like protein
12	9606.ENSP00000262815	0.959	MAU2 chromatid cohesion factor homolog
13	9606.ENSP00000362674	0.949	Histone deacetylase 8
14	9606.ENSP00000378699	0.941	Cyclin-dependent kinase 1
15	9606.ENSP00000256442	0.913	G2/mitotic-specific cyclin-B1
16	9606.ENSP00000288207	0.904	G2/mitotic-specific cyclin-B2
17	9606.ENSP00000257934	0.895	Separin
18	9606.ENSP00000300093	0.850	Serine/threonine-protein kinase PLK1
19	9606.ENSP00000262315	0.836	Chromosome transmission fidelity protein 18 homolog
20	9606.ENSP00000263753	0.799	Shugoshin 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140083	1.000	ATP-dependent protein-DNA unloader activity
GO:1901363	0.477	heterocyclic compound binding
GO:0097159	0.472	organic cyclic compound binding
GO:0003676	0.361	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0065007	0.996	biological regulation
GO:0006275	0.990	regulation of DNA replication
GO:0016043	0.983	cellular component organization
GO:0033044	0.979	regulation of chromosome organization
GO:0034502	0.974	protein localization to chromosome
GO:0010564	0.970	regulation of cell cycle process
GO:0000070	0.970	mitotic sister chromatid segregation
GO:0010605	0.962	negative regulation of macromolecule metabolic process
GO:0045934	0.960	negative regulation of nucleobase-containing compound metabolic process
GO:0051053	0.932	negative regulation of DNA metabolic process
GO:0065009	0.920	regulation of molecular function
GO:0010948	0.913	negative regulation of cell cycle process
GO:0010639	0.866	negative regulation of organelle organization
GO:2001251	0.845	negative regulation of chromosome organization
GO:0008156	0.805	negative regulation of DNA replication
GO:0071168	0.803	protein localization to chromatin
GO:0051098	0.794	regulation of binding
GO:0071704	0.418	organic substance metabolic process
GO:0044238	0.395	primary metabolic process
GO:0048518	0.381	positive regulation of biological process
GO:0044092	0.375	negative regulation of molecular function
GO:0006807	0.368	nitrogen compound metabolic process
GO:0043170	0.354	macromolecule metabolic process
GO:0044237	0.350	cellular metabolic process
GO:0050896	0.326	response to stimulus
GO:0051100	0.310	negative regulation of binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0005654	1.000	nucleoplasm
GO:0000775	0.997	chromosome, centromeric region
GO:0045171	0.996	intercellular bridge
GO:0072686	0.996	mitotic spindle
GO:0000785	0.995	chromatin
GO:0032991	0.952	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]