StarFunc result for job id Q7Z5L9

User Input

>input (587 residues)
MAAAVAVAAASRRQSCYLCDLPRMPWAMIWDFTEPVCRGCVNYEGADRVEFVIETARQLK
RAHGCFPEGRSPPGAAASAAAKPPPLSAKDILLQQQQQLGHGGPEAAPRAPQALERYPLA
AAAERPPRLGSDFGSSRPAASLAQPPTPQPPPVNGILVPNGFSKLEEPPELNRQSPNPRR
GHAVPPTLVPLMNGSATPLPTALGLGGRAAASLAAVSGTAAASLGSAQPTDLGAHKRPAS
VSSSAAVEHEQREAAAKEKQPPPPAHRGPADSLSTAAGAAELSAEGAGKSRGSGEQDWVN
RPKTVRDTLLALHQHGHSGPFESKFKKEPALTAGRLLGFEANGANGSKAVARTARKRKPS
PEPEGEVGPPKINGEAQPWLSTSTEGLKIPMTPTSSFVSPPPPTASPHSNRTTPPEAAQN
GQSPMAALILVADNAGGSHASKDANQVHSTTRRNSNSPPSPSSMNQRRLGPREVGGQGAG
NTGGLEPVHPASLPDSSLATSAPLCCTLCHERLEDTHFVQCPSVPSHKFCFPCSRQSIKQ
QGASGEVYCPSGEKCPLVGSNVPWAFMQGEIATILAGDVKVKKERDS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z5L9	0.999	0.999	8.413E-89	587	1.000	1.000	Q7Z5L9.pdb.gz	I2BP2_HUMAN Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2
2	AFDB:Q7T2G1	0.308	0.354	1.547E-44	501	0.526	0.617	Q7T2G1.pdb.gz	I2B2B_DANRE Interferon regulatory factor 2-binding protein 2-B OS=Danio rerio OX=7955 GN=irf2bp2b PE=2 SV=1
3	AFDB:M9PHN7	0.183	0.184	1.239E-22	585	0.337	0.338	M9PHN7.pdb.gz	M9PHN7_DROME Protein interacting with Ttk69 and Sin3A, isoform E OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
4	AFDB:B7Z143	0.174	0.163	3.794E-22	630	0.317	0.295	B7Z143.pdb.gz	B7Z143_DROME Protein interacting with Ttk69 and Sin3A, isoform D OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
5	AFDB:F4KE59	0.066	0.037	8.126E-2	1311	0.138	0.062	F4KE59.pdb.gz	PAIP2_ARATH Protein PARALOG OF AIPP2 OS=Arabidopsis thaliana OX=3702 GN=PAIPP2 PE=1 SV=1
6	PDB:7od1A	0.088	0.117	1.059E-1	430	0.022	0.030	7od1A.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
7	PDB:4kblA	0.087	0.125	1.915E-1	395	0.022	0.033	4kblA.pdb.gz	Structure of HHARI, a RING-IBR-RING Ubiquitin Ligase: Autoinhibition of an Ariadne-Family E3 and Insights into Ligation Mechanism.
8	AFDB:Q09457	0.046	0.034	3.032E-1	948	0.203	0.126	Q09457.pdb.gz	BLI1_CAEEL Cuticle collagen bli-1 OS=Caenorhabditis elegans OX=6239 GN=bli-1 PE=2 SV=2
9	PDB:7b5lH	0.085	0.113	3.243E-1	423	0.026	0.035	7b5lH.pdb.gz	Ubiquitin ligation to F-box protein targets by SCF-RBR E3-E3 super-assembly.
10	PDB:7oniH	0.086	0.129	3.699E-1	380	0.019	0.029	7oniH.pdb.gz	CUL5-ARIH2 E3-E3 ubiquitin ligase structure reveals cullin-specific NEDD8 activation.
11	AFDB:P47043	0.075	0.057	3.946E-1	880	0.128	0.085	P47043.pdb.gz	ZAP1_YEAST Zinc-responsive transcriptional regulator ZAP1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=ZAP1 PE=1 SV=1
12	AFDB:Q9BVI0	0.063	0.041	3.946E-1	1012	0.131	0.076	Q9BVI0.pdb.gz	PHF20_HUMAN PHD finger protein 20 OS=Homo sapiens OX=9606 GN=PHF20 PE=1 SV=2
13	AFDB:F4JLV7	0.062	0.066	4.501E-1	530	0.150	0.166	F4JLV7.pdb.gz	F4JLV7_ARATH Bifunctional inhibitor/lipid-transfer protein/seed storage 2S albumin superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g22505 PE=1 SV=1
14	AFDB:Q54ET8	0.069	0.056	5.135E-1	810	0.099	0.072	Q54ET8.pdb.gz	Q54ET8_DICDI C2H2-type zinc finger-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0291342 PE=4 SV=2
15	PDB:2m1sA	0.064	0.244	6.264E-1	99	0.031	0.182	2m1sA.pdb.gz	Structural characterization of the Z RING-eIF4E complex reveals a distinct mode of control for eIF4E
16	PDB:1imlA	0.040	0.278	1.380	76	0.009	0.066	1imlA.pdb.gz	Structure of the cysteine-rich intestinal protein, CRIP.
17	PDB:4kfzB	0.049	0.165	1.380	148	0.014	0.054	4kfzB.pdb.gz	Conformational flexibility of the oncogenic protein LMO2 primes the formation of the multi-protein transcription complex.
18	PDB:1e7dA	0.067	0.200	2.848	157	0.020	0.076	1e7dA.pdb.gz	Conformational Flexibility in T4 Endonuclease Vii Revealed by Crystallography: Implications for Substrate Binding and Cleavage
19	PDB:6ft6u	0.062	0.201	2.848	150	0.026	0.100	6ft6u.pdb.gz	Structure of the nuclear exosome captured on a maturing preribosome.
20	PDB:7uhyD	0.053	0.093	3.249	288	0.020	0.042	7uhyD.pdb.gz	Structure of the nutrient-sensing hub GATOR2.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z5L9	0.0	1177	587	1.000	1.000	I2BP2_HUMAN Interferon regulatory factor 2-binding protein 2 OS=Homo sapiens OX=9606 GN=IRF2BP2 PE=1 SV=2
2	Q7T2G1	1.08e-174	506	501	0.535	0.627	I2B2B_DANRE Interferon regulatory factor 2-binding protein 2-B OS=Danio rerio OX=7955 GN=irf2bp2b PE=2 SV=1
3	Q2MJS2	3.10e-77	262	794	0.266	0.196	I2BPL_MACMU Probable E3 ubiquitin-protein ligase IRF2BPL OS=Macaca mulatta OX=9544 GN=IRF2BPL PE=2 SV=1
4	Q9H1B7	5.59e-77	261	796	0.264	0.195	I2BPL_HUMAN Probable E3 ubiquitin-protein ligase IRF2BPL OS=Homo sapiens OX=9606 GN=IRF2BPL PE=1 SV=1
5	Q5EIC4	1.46e-76	260	783	0.262	0.197	I2BPL_RAT Probable E3 ubiquitin-protein ligase IRF2BPL OS=Rattus norvegicus OX=10116 GN=Irf2bpl PE=1 SV=1
6	Q8IU81	2.97e-50	184	584	0.203	0.204	I2BP1_HUMAN Interferon regulatory factor 2-binding protein 1 OS=Homo sapiens OX=9606 GN=IRF2BP1 PE=1 SV=1
7	M9PHN7	1.19e-35	143	585	0.109	0.109	M9PHN7_DROME Protein interacting with Ttk69 and Sin3A, isoform E OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
8	Q9VYL7	1.37e-35	143	615	0.109	0.104	Q9VYL7_DROME Protein interacting with Ttk69 and Sin3A, isoform C OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=2
9	Q8MS22	1.41e-35	143	615	0.109	0.104	Q8MS22_DROME RE41430p OS=Drosophila melanogaster OX=7227 GN=Pits PE=2 SV=1
10	B7Z143	1.77e-35	143	630	0.109	0.102	B7Z143_DROME Protein interacting with Ttk69 and Sin3A, isoform D OS=Drosophila melanogaster OX=7227 GN=Pits PE=3 SV=1
11	P92004	4.05e-33	134	457	0.099	0.127	P92004_CAEEL Interferon regulatory factor 2-binding protein 1 & 2 zinc finger domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=tag-260 PE=1 SV=2
12	Q8NHY2	0.45	35.8	731	0.032	0.026	COP1_HUMAN E3 ubiquitin-protein ligase COP1 OS=Homo sapiens OX=9606 GN=COP1 PE=1 SV=1
13	O43593	0.98	35.0	1189	0.026	0.013	HAIR_HUMAN Lysine-specific demethylase hairless OS=Homo sapiens OX=9606 GN=HR PE=1 SV=5

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14442 Bd3614_N	1.5e+02	14.1	Bd3614-like deaminase N-terminal
2	PF11261 IRF-2BP1_2	1.5e-31	119.0	Interferon regulatory factor 2-binding protein zinc finger
3	PF00097 zf-C3HC4	1	20.6	Zinc finger, C3HC4 type (RING finger)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000355568

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000404251	0.971	Transcription cofactor vestigial-like protein 4
2	9606.ENSP00000377218	0.952	Interferon regulatory factor 2
3	9606.ENSP00000307265	0.809	Interferon regulatory factor 2-binding protein 1
4	9606.ENSP00000238647	0.731	Interferon regulatory factor 2-binding protein-like
5	9606.ENSP00000379330	0.601	Nuclear factor of activated T-cells, cytoplasmic 2
6	9606.ENSP00000464036	0.591	Cyclin-dependent kinase 11B
7	9606.ENSP00000254066	0.521	Retinoic acid receptor alpha
8	9606.ENSP00000364699	0.518	Succinate dehydrogenase [ubiquinone] cytochrome b small subunit, mitochondrial
9	9606.ENSP00000354498	0.517	Pleckstrin homology like domain family B member 1
10	9606.ENSP00000360107	0.515	EF-hand domain-containing protein 1
11	9606.ENSP00000268616	0.505	Zinc finger CCHC domain-containing protein 14
12	9606.ENSP00000296955	0.505	Discoidin, CUB and LCCL domain containing 1
13	9606.ENSP00000319482	0.505	DCN1-like protein 3
14	9606.ENSP00000231656	0.502	Homeobox protein CDX-1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0003714	0.999	transcription corepressor activity
GO:0005488	0.960	binding
GO:0005515	0.867	protein binding
GO:0097159	0.681	organic cyclic compound binding
GO:1901363	0.665	heterocyclic compound binding
GO:0003824	0.645	catalytic activity
GO:0003676	0.388	nucleic acid binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0080090	0.989	regulation of primary metabolic process
GO:0051171	0.988	regulation of nitrogen compound metabolic process
GO:0010556	0.987	regulation of macromolecule biosynthetic process
GO:0031326	0.987	regulation of cellular biosynthetic process
GO:0009987	0.985	cellular process
GO:0051252	0.983	regulation of RNA metabolic process
GO:0010468	0.981	regulation of gene expression
GO:0006355	0.971	regulation of DNA-templated transcription
GO:0048523	0.936	negative regulation of cellular process
GO:0009890	0.917	negative regulation of biosynthetic process
GO:0006357	0.916	regulation of transcription by RNA polymerase II
GO:0045892	0.912	negative regulation of DNA-templated transcription
GO:0032502	0.899	developmental process
GO:0048856	0.893	anatomical structure development
GO:0032501	0.864	multicellular organismal process
GO:0002521	0.685	leukocyte differentiation
GO:0002376	0.579	immune system process
GO:0001775	0.568	cell activation
GO:1903131	0.560	mononuclear cell differentiation
GO:0000122	0.512	negative regulation of transcription by RNA polymerase II
GO:0046649	0.419	lymphocyte activation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	1.000	nucleoplasm
GO:0005737	0.627	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]