StarFunc result for job id Q7Z5M5

User Input

>input (1100 residues)
MKTSKASQRYRGIRRNASQCYLYQESLLLSNLDDSFSADETGDSNDPEQIFQNIQFQKDL
MANIRCRPWTMGQKLRALRQAKNIVLKFEGRLTRTRGYQAAGAELWRKFARLACNFVVIF
IPWEMRIKKIESHFGSGVASYFIFLRWLFGINIVLTIMTGAFIVIPELIAGQPFGSTARK
TIPKEQVSSAQDLDTVWSLGGYLQYSVLFYGYYGRERKIGRAGYRLPLAYFLVGMAVFAY
SFIILLKKMAKNSRTSLASASNENYTFCWRVFCAWDYLIGNPEAAESKTAAIVNSIREAI
LEEQEKKKSKNLAVTICLRIIANILVLLSLAGSIYLIYFVVDRSQKLEQSKKELTLWEKN
EVSVVVSLVTMIAPSAFDLIAALEMYHPRTTLRFQLARVLVLYLGNLYSLIIALLDKVNS
MSIEEMATKNNTSHWIDSTTFFATRTAPEEEKWSTSRPGMGLRRNNTWALEETSISAYTM
PLIKANKTSLHTQSPQDQCWETYVGQEMLKLSIIDMLFTVASILLIDFFRGLFVRYLSDY
WCWDLESKFPEYGEFKIAENVLHLVYNQGMIWMGAFFSPCLPAFNVLKLIGLMYLRSWAV
LTCNVPHQQVFRASRSNNFYLAMLLFMLFLCMLPTIFAIVRYKPSLNCGPFSGQEKIYDI
VSETIEKDFPVWFGSVVGHISSPVVILPAVLLLFMLIYYLQSIARSLKLSNHQLKMQIQN
ARSEDKKKVAQMVEARIQTQEESTKKLPNDSDLTSQLSSAHSGTPQNNGNVAHFDSGSSK
SGRIETVAQSMPQSPRPGDRAPSSPLPGVPKSRLEHETNRYLHGLCASTSDLHRNRSRTP
MTFTTHIEDVHSEPLFRKDFQQINPPHRGPQASTLLAQGPRPHAPRYYVINECDSYKKKH
LNVWPERHFKIDASGDIVELYPRNVRQYASRVPRQPPSPQLSEEEEETPSRDWIKRSLPP
RSLIDLRRAPHFYIGERSESQTRDPEHQGRVHYKSWNEDFEGHLERPAYVPRKPRSRNFQ
YPQPPLKPRGKPRFEPSLTESDSVSAASSSDQQNSSADQYLQVTHSQGRFPRSVGQPSRR
KAKSGQELTVDLDDLICSDV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:F1QZE9	0.503	0.611	1.383E-56	892	0.290	0.358	F1QZE9.pdb.gz	TMC2B_DANRE Transmembrane channel-like protein 2-B OS=Danio rerio OX=7955 GN=tmc2b PE=2 SV=2
2	AFDB:Q8R4P4	0.544	0.662	7.321E-56	888	0.295	0.365	Q8R4P4.pdb.gz	TMC2_MOUSE Transmembrane channel-like protein 2 OS=Mus musculus OX=10090 GN=Tmc2 PE=1 SV=1
3	AFDB:F1QFU0	0.523	0.609	5.077E-55	935	0.301	0.354	F1QFU0.pdb.gz	TMC1_DANRE Transmembrane channel-like protein 1 OS=Danio rerio OX=7955 GN=tmc1 PE=1 SV=2
4	AFDB:E7FFT2	0.527	0.625	2.554E-53	916	0.293	0.352	E7FFT2.pdb.gz	TMC2A_DANRE Transmembrane channel-like protein 2-A OS=Danio rerio OX=7955 GN=tmc2a PE=1 SV=2
5	AFDB:Q8R4P5	0.524	0.742	4.960E-51	757	0.264	0.383	Q8R4P5.pdb.gz	TMC1_MOUSE Transmembrane channel-like protein 1 OS=Mus musculus OX=10090 GN=Tmc1 PE=1 SV=1
6	AFDB:A4FUA6	0.504	0.737	2.953E-47	740	0.255	0.378	A4FUA6.pdb.gz	A4FUA6_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
7	PDB:7uswA	0.477	0.817	4.292E-42	608	0.250	0.452	7uswA.pdb.gz	Structures of the TMC-1 complex illuminate mechanosensory transduction.
8	PDB:8b8kA	0.220	0.304	1.215E-3	741	0.049	0.073	8b8kA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
9	PDB:6r7xA	0.230	0.369	1.271E-3	629	0.065	0.114	6r7xA.pdb.gz	The structural basis of lipid scrambling and inactivation in the endoplasmic reticulum scramblase TMEM16K.
10	PDB:8bc1A	0.227	0.424	1.592E-3	527	0.050	0.104	8bc1A.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
11	PDB:7zk3A	0.253	0.370	3.128E-3	721	0.056	0.086	7zk3A.pdb.gz	Inhibition mechanism of the chloride channel TMEM16A by the pore blocker 1PBC.
12	PDB:8b8jA	0.227	0.328	3.272E-3	709	0.046	0.072	8b8jA.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
13	PDB:8bc0B	0.225	0.360	5.617E-3	636	0.046	0.080	8bc0B.pdb.gz	Structural basis for the activation of the lipid scramblase TMEM16F.
14	PDB:6p47A	0.216	0.304	9.643E-3	725	0.056	0.086	6p47A.pdb.gz
15	PDB:6qm5A	0.219	0.330	1.982E-2	673	0.053	0.086	6qm5A.pdb.gz	Stepwise activation mechanism of the scramblase nhTMEM16 revealed by cryo-EM.
16	AFDB:Q8CIR4	0.063	0.037	2.078E-2	2028	0.112	0.061	Q8CIR4.pdb.gz	TRPM6_MOUSE Transient receptor potential cation channel subfamily M member 6 OS=Mus musculus OX=10090 GN=Trpm6 PE=2 SV=1
17	PDB:6mgvA	0.177	0.288	2.717E-2	634	0.083	0.144	6mgvA.pdb.gz
18	AFDB:Q13936	0.077	0.051	1.577E-1	2221	0.141	0.070	Q13936.pdb.gz	CAC1C_HUMAN Voltage-dependent L-type calcium channel subunit alpha-1C OS=Homo sapiens OX=9606 GN=CACNA1C PE=1 SV=4
19	AFDB:Q8C419	0.077	0.073	1.888E-1	1200	0.092	0.084	Q8C419.pdb.gz	MGLYR_MOUSE Metabotropic glycine receptor OS=Mus musculus OX=10090 GN=Gpr158 PE=1 SV=2
20	AFDB:A1Z8P9	0.060	0.033	5.320E-1	2346	0.140	0.066	A1Z8P9.pdb.gz	TPR_DROME Nucleoprotein TPR OS=Drosophila melanogaster OX=7227 GN=Mtor PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2KB87	0.0	561	659	0.262	0.437	A0A0G2KB87_RAT Transmembrane channel-like protein OS=Rattus norvegicus OX=10116 GN=Tmc1 PE=3 SV=2
2	E7FFT2	0.0	618	916	0.274	0.329	TMC2A_DANRE Transmembrane channel-like protein 2-A OS=Danio rerio OX=7955 GN=tmc2a PE=1 SV=2
3	F1QFU0	0.0	627	935	0.292	0.343	TMC1_DANRE Transmembrane channel-like protein 1 OS=Danio rerio OX=7955 GN=tmc1 PE=1 SV=2
4	F1QZE9	0.0	599	892	0.287	0.354	TMC2B_DANRE Transmembrane channel-like protein 2-B OS=Danio rerio OX=7955 GN=tmc2b PE=2 SV=2
5	Q8R4P4	0.0	637	888	0.292	0.361	TMC2_MOUSE Transmembrane channel-like protein 2 OS=Mus musculus OX=10090 GN=Tmc2 PE=1 SV=1
6	Q8R4P5	0.0	564	757	0.260	0.378	TMC1_MOUSE Transmembrane channel-like protein 1 OS=Mus musculus OX=10090 GN=Tmc1 PE=1 SV=1
7	Q8TDI7	0.0	642	906	0.298	0.362	TMC2_HUMAN Transmembrane channel-like protein 2 OS=Homo sapiens OX=9606 GN=TMC2 PE=2 SV=3
8	Q3MI88	2.58e-178	541	727	0.253	0.382	Q3MI88_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
9	A5D8Y1	7.11e-177	538	739	0.250	0.372	A5D8Y1_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
10	A4FUA6	7.99e-177	538	740	0.250	0.372	A4FUA6_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
11	A4FU59	6.74e-125	395	554	0.192	0.381	A4FU59_HUMAN Transmembrane channel-like protein (Fragment) OS=Homo sapiens OX=9606 GN=TMC1 PE=2 SV=1
12	A0A0U1QT59	2.26e-85	306	2036	0.144	0.078	TMC_DROME Transmembrane channel-like protein OS=Drosophila melanogaster OX=7227 GN=Tmc PE=1 SV=1
13	D3KZG3	2.99e-85	304	1285	0.145	0.125	TMC1_CAEEL Transmembrane channel-like protein 1 OS=Caenorhabditis elegans OX=6239 GN=tmc-1 PE=1 SV=2
14	Q8C5T3	1.54e-32	125	152	0.054	0.388	Q8C5T3_MOUSE Transmembrane channel-like protein OS=Mus musculus OX=10090 GN=Tmc1 PE=2 SV=1
15	Q8CCC1	2.10e-27	110	131	0.050	0.420	Q8CCC1_MOUSE Uncharacterized protein (Fragment) OS=Mus musculus OX=10090 GN=Tmc1 PE=2 SV=1
16	Q6UXY8	6.63e-22	105	1006	0.068	0.075	TMC5_HUMAN Transmembrane channel-like protein 5 OS=Homo sapiens OX=9606 GN=TMC5 PE=2 SV=3
17	E7FDU7	2.17e-20	99.4	685	0.073	0.117	E7FDU7_DANRE Transmembrane channel-like protein OS=Danio rerio OX=7955 GN=si:dkey-202l16.5 PE=3 SV=1
18	Q7Z404	1.55e-19	96.7	712	0.071	0.110	TMC4_HUMAN Transmembrane channel-like protein 4 OS=Homo sapiens OX=9606 GN=TMC4 PE=1 SV=3
19	Q7Z403	1.94e-19	96.7	805	0.067	0.092	TMC6_HUMAN Transmembrane channel-like protein 6 OS=Homo sapiens OX=9606 GN=TMC6 PE=1 SV=2
20	Q8IU68	7.68e-19	94.7	726	0.064	0.096	TMC8_HUMAN Transmembrane channel-like protein 8 OS=Homo sapiens OX=9606 GN=TMC8 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05966 Chordopox_A33R	4.8e+02	11.4	Chordopoxvirus A33R protein
2	PF10011 DUF2254	4.4e+02	11.0	Predicted membrane protein (DUF2254)
3	PF10883 DUF2681	5.7e+02	12.2	Protein of unknown function (DUF2681)
4	PF07810 TMC	4e-35	132.1	TMC domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000352413

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000376472	0.820	Dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3A
2	9606.ENSP00000324775	0.775	Transmembrane inner ear expressed protein
3	9606.ENSP00000265981	0.774	RING finger protein 141
4	9606.ENSP00000267984	0.764	Talin rod domain-containing protein 1
5	9606.ENSP00000261758	0.726	LRP chaperone MESD
6	9606.ENSP00000353346	0.614	LHFPL tetraspan subfamily member 5 protein
7	9606.ENSP00000482819	0.602	Zinc finger protein 343
8	9606.ENSP00000357126	0.560	Olfactory receptor 6K6
9	9606.ENSP00000286732	0.558	Cilia- and flagella-associated protein 161
10	9606.ENSP00000341938	0.529	Sulfatase-modifying factor 2
11	9606.ENSP00000349456	0.527	Chloride channel CLIC-like protein 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:1901702	0.998	salt transmembrane transporter activity
GO:0046873	0.998	metal ion transmembrane transporter activity
GO:0005261	0.998	monoatomic cation channel activity
GO:0008381	0.754	mechanosensitive monoatomic ion channel activity
GO:0005262	0.739	calcium channel activity
GO:0005245	0.652	voltage-gated calcium channel activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.759	cellular process
GO:0032501	0.726	multicellular organismal process
GO:0050789	0.678	regulation of biological process
GO:0050794	0.590	regulation of cellular process
GO:0050896	0.453	response to stimulus
GO:0050877	0.448	nervous system process
GO:0007600	0.443	sensory perception
GO:0050910	0.373	detection of mechanical stimulus involved in sensory perception of sound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043226	0.999	organelle
GO:0016020	0.995	membrane
GO:0043227	0.993	membrane-bounded organelle
GO:0005622	0.992	intracellular anatomical structure
GO:0005737	0.957	cytoplasm
GO:0043231	0.951	intracellular membrane-bounded organelle
GO:0005886	0.936	plasma membrane
GO:0120025	0.541	plasma membrane bounded cell projection
GO:0012505	0.532	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:29671	0.739	Ca(2+)(in) = Ca(2+)(out)

[back to server]