StarFunc result for job id Q7Z5P9

User Input

>input (1400 residues)
MKLILWYLVVALWCFFKDVEALLYRQKSDGKIAASRSGGFSYGSSSSGDLDRKKPLFSLE
FGSPGETEDKSRQRQDAGSPKSEDTPAGGFFNSSSSSGDSDRTKPFFSLGLGAPGKAEDK
SGDSQDAGGSKSEDTPPGGFFYGSSSSGDSDKKKPLFSFEFGATGEDEDKSRERWDAGNS
RSEDSPADSTNTRYGAGFSSSGASLDVGFGWGISDEKGLEVSKADGRETRGSGSAGGETI
VFGPDAGSSVGTGSSGLKLGAGKGDAAFGFEVSDSNSFGDTGISSKTVEGNQTSSSGGSV
SIDLGDTSFRSENQFVGGGSLNSISNLWDSGQEGFGINEIGGNGMSGSVSAEAGFKGFGS
DSSSSGDSSARNGFENSSGISEDSGVILGSSDQHEVELSRTGGNRKRSSDPDEAGNLSPG
SDVSDSGGNTWSSDSGSGGGGVTSSSEYSTSGPLNTPEKGSHIPEATPKYSETNAIIGEI
STWSKGAYKSFNGRIFFFESSCPYTFCRHCIESGGDFNIEIKRNNDSEIEKITVLIDNND
VSIFGDTILVNGESVQIPYNNKLIHIKKYGEHNVLNSRRGILTLMWDKNNKLSLTLHKQY
PTCGLCGNFNSTPGQDINEHIANSKIPGDCPNAVGKSYEVCEDGIQHCNKIIGTYFEKCG
KVAALSNDYKMICIDEYCQTRDKTSTCDTYSELSRLCASDGPGTFESWRSDSDVVCGTQR
CPEQHIYKECGPSNPATCSNVAPFQDSECVSGCTCPEGYLLDDIGEKGKCVLKAECPCES
SGTVYQPGEVREGPCGSQCTCQDAKWSCTEALCPGRCKVEGSSLTTFDGVKYNFPGNCHF
LAVHNEDWSISVELRPCPSGQTGTCLNSVTLLLNSSVPVDKYVFNSDGTVTNDKIRNQGY
YYSDKIQIFNASSSYLQVETYFHVKLQIQIVPVMQLYVSMPPNQFTDTVGLCGSYNNKAE
DDFMSSQNILEKTSQAFANSWEMMSCPKGNPSSCISIEKEKFAERHCGILLDSSGPLASC
HPIVNPKPYHEECKKYTCTCENSQDCLCTILGNYVKACAEKETYIVGWRTGLCEHSCPSG
LVFKYNVKACNSSCRSLSERDRSCDVEDVPVDGCTCPDAMYQNNEGNCVLKSQCDCYIND
EVMQPGKLIHIDDNKCVCRDGILLCQIPIDLTLQNCSGGAEYVDCSDPKAQRRTNRTCST
RNIPVFDENLPCKRGCFCPEGMVRNSKGICVFPNDCPCSFGGREYDEGSVTSVGCNECTC
IKGSWSCTQNECQTICHIYGEGHVRTFDGKSYSFDGLCQYSFLEDYCGHENGTFRILTES
VPCCEDGLTCSRKIIVAFQDQNIVLQDGKVTAVKSTESKKCELNANAYSIHTVGLYLILK
FQNGIIVIWDKNTRLSVILD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q6W4X9	0.607	0.355	1.269E-72	2439	0.214	0.123	Q6W4X9.pdb.gz	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
2	PDB:6z3mc	0.088	0.652	5.316E-6	158	0.019	0.171	6z3mc.pdb.gz	Repulsive guidance molecules lock growth differentiation factor 5 in an inhibitory complex.
3	AFDB:Q6UXX5	0.079	0.084	2.089E-4	1313	0.067	0.072	Q6UXX5.pdb.gz	ITIH6_HUMAN Inter-alpha-trypsin inhibitor heavy chain H6 OS=Homo sapiens OX=9606 GN=ITIH6 PE=1 SV=1
4	AFDB:P38800	0.049	0.050	3.410E-3	1345	0.121	0.126	P38800.pdb.gz	LAM4_YEAST Membrane-anchored lipid-binding protein LAM4 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=LAM4 PE=1 SV=1
5	AFDB:A0A0G2K490	0.042	0.043	8.216E-3	1360	0.082	0.085	A0A0G2K490.pdb.gz	A0A0G2K490_RAT TRAF2 and NCK interacting kinase OS=Rattus norvegicus OX=10116 GN=Tnik PE=1 SV=1
6	PDB:5hxbY	0.052	0.064	8.225E-3	1080	0.041	0.053	5hxbY.pdb.gz	A novel cereblon modulator recruits GSPT1 to the CRL4(CRBN) ubiquitin ligase.
7	PDB:1kv9A	0.049	0.076	1.181E-2	664	0.046	0.098	1kv9A.pdb.gz	Structure at 1.9 A resolution of a quinohemoprotein alcohol dehydrogenase from Pseudomonas putida HK5.
8	PDB:6xk9Y	0.050	0.060	1.697E-2	1106	0.039	0.049	6xk9Y.pdb.gz	CC-90009, a novel cereblon E3 ligase modulator, targets acute myeloid leukemia blasts and leukemia stem cells.
9	PDB:6xt9A	0.043	0.081	1.697E-2	567	0.036	0.088	6xt9A.pdb.gz
10	PDB:2hyeA	0.044	0.049	1.982E-2	1140	0.041	0.050	2hyeA.pdb.gz	Molecular architecture and assembly of the DDB1-CUL4A ubiquitin ligase machinery.
11	PDB:5wyjBE	0.054	0.077	1.982E-2	753	0.029	0.054	5wyjBE.pdb.gz	Molecular architecture of the 90S small subunit pre-ribosome.
12	PDB:7mq8LT	0.044	0.059	1.982E-2	869	0.061	0.098	7mq8LT.pdb.gz	Nucleolar maturation of the human small subunit processome.
13	PDB:5lj5t	0.039	0.083	2.197E-2	438	0.027	0.087	5lj5t.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.
14	PDB:6r8yK	0.057	0.081	2.703E-2	825	0.043	0.073	6r8yK.pdb.gz	DNA damage detection in nucleosomes involves DNA register shifting.
15	AFDB:A1ZBH7	0.067	0.070	2.843E-2	1218	0.080	0.092	A1ZBH7.pdb.gz	A1ZBH7_DROME Happyhour, isoform A OS=Drosophila melanogaster OX=7227 GN=hppy PE=1 SV=1
16	AFDB:P34288	0.036	0.033	4.083E-2	1605	0.085	0.074	P34288.pdb.gz	PAC1_CAEEL GTPase-activating protein pac-1 OS=Caenorhabditis elegans OX=6239 GN=pac-1 PE=1 SV=4
17	AFDB:B7YZK8	0.042	0.040	5.568E-2	1517	0.082	0.076	B7YZK8.pdb.gz	B7YZK8_DROME Thin, isoform C OS=Drosophila melanogaster OX=7227 GN=tn PE=1 SV=1
18	AFDB:Q13009	0.054	0.050	6.175E-2	1591	0.104	0.092	Q13009.pdb.gz	TIAM1_HUMAN Rho guanine nucleotide exchange factor TIAM1 OS=Homo sapiens OX=9606 GN=TIAM1 PE=1 SV=2
19	AFDB:Q9FUY2	0.044	0.057	8.422E-2	931	0.083	0.125	Q9FUY2.pdb.gz	LEUNG_ARATH Transcriptional corepressor LEUNIG OS=Arabidopsis thaliana OX=3702 GN=LUG PE=1 SV=2
20	AFDB:Q5VT97	0.051	0.054	1.274E-1	1194	0.086	0.101	Q5VT97.pdb.gz	SYDE2_HUMAN Rho GTPase-activating protein SYDE2 OS=Homo sapiens OX=9606 GN=SYDE2 PE=1 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6PZE0	0.0	1597	7524	0.489	0.091	MUC19_MOUSE Mucin-19 OS=Mus musculus OX=10090 GN=Muc19 PE=2 SV=2
2	Q7Z5P9	0.0	3112	8384	1.000	0.167	MUC19_HUMAN Mucin-19 OS=Homo sapiens OX=9606 GN=MUC19 PE=1 SV=3
3	Q62635	2.49e-167	543	1513	0.242	0.224	MUC2_RAT Mucin-2 (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc2 PE=1 SV=1
4	P98088	3.07e-162	545	5654	0.236	0.058	MUC5A_HUMAN Mucin-5AC OS=Homo sapiens OX=9606 GN=MUC5AC PE=1 SV=4
5	Q8BYW0	1.87e-160	524	1477	0.235	0.223	Q8BYW0_MOUSE VWFD domain-containing protein (Fragment) OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
6	E9Q5I3	3.44e-157	530	4800	0.234	0.068	E9Q5I3_MOUSE Mucin 5, subtype B, tracheobronchial OS=Mus musculus OX=10090 GN=Muc5b PE=1 SV=1
7	Q02817	9.50e-157	528	5179	0.236	0.064	MUC2_HUMAN Mucin-2 OS=Homo sapiens OX=9606 GN=MUC2 PE=1 SV=3
8	Q8K1G6	1.83e-156	528	4782	0.234	0.069	Q8K1G6_MOUSE Muc5b protein OS=Mus musculus OX=10090 GN=Muc5b PE=2 SV=1
9	E9QAQ8	9.80e-155	522	3455	0.229	0.093	E9QAQ8_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=5
10	Q9HC84	5.14e-154	520	5762	0.242	0.059	MUC5B_HUMAN Mucin-5B OS=Homo sapiens OX=9606 GN=MUC5B PE=1 SV=3
11	Q80Z19	2.97e-153	517	2680	0.239	0.125	MUC2_MOUSE Mucin-2 OS=Mus musculus OX=10090 GN=Muc2 PE=1 SV=3
12	Q9ESP3	4.81e-153	510	1851	0.229	0.173	Q9ESP3_RAT Mucin (Fragment) OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=2 SV=1
13	E9PWB6	3.76e-152	514	2751	0.229	0.116	E9PWB6_MOUSE Mucin 5, subtypes A and C, tracheobronchial/gastric OS=Mus musculus OX=10090 GN=Muc5ac PE=1 SV=1
14	A0A0G2K8X5	9.89e-151	510	3922	0.229	0.082	A0A0G2K8X5_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
15	A0A0G2K1Y4	1.06e-150	510	3586	0.229	0.090	A0A0G2K1Y4_RAT Mucin 5AC, oligomeric mucus/gel-forming OS=Rattus norvegicus OX=10116 GN=Muc5ac PE=4 SV=2
16	F1NBL0	1.42e-141	466	1185	0.216	0.256	MUC6_CHICK Mucin-6 (Fragment) OS=Gallus gallus OX=9031 GN=MUC6 PE=1 SV=1
17	Q98UI9	4.18e-138	471	2108	0.227	0.151	MUC5B_CHICK Mucin-5B OS=Gallus gallus OX=9031 GN=MUC5B PE=1 SV=1
18	Q6W4X9	8.40e-137	468	2439	0.215	0.123	MUC6_HUMAN Mucin-6 OS=Homo sapiens OX=9606 GN=MUC6 PE=1 SV=3
19	O55225	7.14e-102	363	2911	0.197	0.095	OTOG_MOUSE Otogelin OS=Mus musculus OX=10090 GN=Otog PE=1 SV=3
20	E7F9Z1	7.96e-101	359	2812	0.205	0.102	E7F9Z1_DANRE von Willebrand factor OS=Danio rerio OX=7955 GN=VWF PE=1 SV=3

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08742 C8	2.1e-15	68.1	C8 domain
2	PF05375 Pacifastin_I	4.3	18.5	Pacifastin inhibitor (LCMII)
3	PF01826 TIL	8.2e-09	46.8	Trypsin Inhibitor like cysteine rich domain
4	PF00094 VWD	2.6e-58	208.2	von Willebrand factor type D domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9597.XP_008949701.1

Rank	PPI partner	STRING score	Description
1	9597.XP_003813591.1	0.994	SGT1 homolog, MIS12 kinetochore complex assembly cochaperone
2	9597.XP_003825774.1	0.917	Leucine-rich repeat serine/threonine-protein kinase 2
3	9597.XP_008964762.1	0.895	Derived by automated computational analysis using gene prediction method: Gnomon. Supporting evidence includes similarity to: 1 mRNA, 14 ESTs, 1 Protein, and 88% coverage of the annotated genomic feature by RNAseq alignments, including 5 samples with support for all annotated introns
4	9597.XP_008976806.1	0.889	Prostaglandin E synthase 3
5	9597.XP_003825353.1	0.879	60 kDa heat shock protein, mitochondrial
6	9597.XP_003808926.1	0.825	Activator of HSP90 ATPase activity 1
7	9597.XP_008954549.1	0.825	Activator of HSP90 ATPase homolog 2
8	9597.XP_008959176.1	0.797	STIP1 homology and U-box containing protein 1
9	9597.XP_003832934.1	0.790	Bardet-Biedl syndrome 10
10	9597.XP_003809637.1	0.770	Cell division cycle 37
11	9597.XP_003823411.1	0.770	Cell division cycle 37 like 1
12	9597.XP_003817539.1	0.767	Serine/threonine-protein phosphatase 5
13	9597.XP_008968937.1	0.767	PPP5 tetratricopeptide repeat domain containing 1
14	9597.XP_003829266.1	0.763	Heat shock protein family A (Hsp70) member 9
15	9597.XP_003829335.1	0.763	Heat shock 70 kDa protein 4 isoform X1
16	9597.XP_008950457.1	0.763	Heat shock protein family H (Hsp110) member 1
17	9597.XP_008974938.1	0.763	Heat shock 70 kDa protein 4L
18	9597.XP_003810114.1	0.750	Acts as a tumor suppressor in many tumor types
19	9597.XP_003805520.1	0.749	Tetratricopeptide repeat domain 12
20	9597.XP_003810386.1	0.749	Tetratricopeptide repeat domain 31

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0042802	0.327	identical protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032501	0.414	multicellular organismal process
GO:0065007	0.349	biological regulation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	0.999	cellular anatomical entity
GO:0043226	0.973	organelle
GO:0005737	0.970	cytoplasm
GO:0043231	0.945	intracellular membrane-bounded organelle
GO:0071944	0.935	cell periphery
GO:0016020	0.874	membrane
GO:0070013	0.864	intracellular organelle lumen
GO:0012505	0.845	endomembrane system
GO:0005886	0.837	plasma membrane
GO:0005794	0.733	Golgi apparatus
GO:0005796	0.545	Golgi lumen
GO:0005576	0.476	extracellular region

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]