StarFunc result for job id Q7Z5Q1

User Input

>input (589 residues)
MPPPSPDSENGFYPGLPSSMNPAFFPSFSPVSPHGCTGLSVPTSGGGGGGFGGPFSATAV
PPPPPPAMNIPQQQPPPPAAPQQPQSRRSPVSPQLQQQHQAAAAAFLQQRNSYNHHQPLL
KQSPWSNHQSSGWGTGSMSWGAMHGRDHRRTGNMGIPGTMNQISPLKKPFSGNVIAPPKF
TRSTPSLTPKSWIEDNVFRTDNNSNTLLPLQVRSSLQLPAWGSDSLQDSWCTAAGTSRID
QDRSRMYDSLNMHSLENSLIDIMRAEHDPLKGRLSYPHPGTDNLLMLNGRSSLFPIDDGL
LDDGHSDQVGVLNSPTCYSAHQNGERIERFSRKVFVGGLPPDIDEDEITASFRRFGPLVV
DWPHKAESKSYFPPKGYAFLLFQEESSVQALIDACIEEDGKLYLCVSSPTIKDKPVQIRP
WNLSDSDFVMDGSQPLDPRKTIFVGGVPRPLRAVELAMIMDRLYGGVCYAGIDTDPELKY
PKGAGRVAFSNQQSYIAAISARFVQLQHGDIDKRVEVKPYVLDDQMCDECQGARCGGKFA
PFFCANVTCLQYYCEFCWANIHSRAGREFHKPLVKEGADRPRQIHFRWN

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:D3ZHK8	0.500	0.412	4.323E-92	717	0.978	0.803	D3ZHK8.pdb.gz	D3ZHK8_RAT Cytoplasmic polyadenylation element binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cpeb2 PE=1 SV=4
2	AFDB:D4AD99	0.442	0.346	3.851E-68	756	0.657	0.512	D4AD99.pdb.gz	D4AD99_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=1 SV=3
3	AFDB:Q7TN99	0.484	0.400	3.766E-67	716	0.655	0.539	Q7TN99.pdb.gz	CPEB3_MOUSE Cytoplasmic polyadenylation element-binding protein 3 OS=Mus musculus OX=10090 GN=Cpeb3 PE=1 SV=1
4	PDB:6y53o	0.179	0.491	3.077E-7	160	0.063	0.231	6y53o.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
5	PDB:7oqcF	0.119	0.247	1.465E-6	267	0.066	0.146	7oqcF.pdb.gz	Structural insights into how Prp5 proofreads the pre-mRNA branch site.
6	PDB:6y5qq	0.115	0.343	5.823E-6	178	0.048	0.157	6y5qq.pdb.gz	Molecular architecture of the human 17S U2 snRNP.
7	PDB:5lsbA	0.112	0.342	3.973E-5	176	0.054	0.182	5lsbA.pdb.gz
8	PDB:7evoD	0.114	0.307	1.242E-4	200	0.051	0.150	7evoD.pdb.gz	Structural Insights into Branch Site Proofreading by Human Spliceosome.
9	PDB:5yzg1	0.125	0.260	1.891E-4	243	0.059	0.144	5yzg1.pdb.gz	Structure of a human catalytic step I spliceosome
10	PDB:5vsuA	0.126	0.186	2.008E-4	387	0.051	0.078	5vsuA.pdb.gz	Architecture of the U6 snRNP reveals specific recognition of 3'-end processed U6 snRNA.
11	PDB:6ff7X	0.109	0.325	2.008E-4	171	0.059	0.205	6ff7X.pdb.gz	Structure and Conformational Dynamics of the Human Spliceosomal BactComplex.
12	PDB:6r5kH	0.119	0.170	2.404E-4	394	0.068	0.102	6r5kH.pdb.gz	Molecular Basis for poly(A) RNP Architecture and Recognition by the Pan2-Pan3 Deadenylase.
13	PDB:6g90B	0.128	0.372	7.079E-4	193	0.037	0.114	6g90B.pdb.gz	Prespliceosome structure provides insights into spliceosome assembly and regulation.
14	AFDB:A0A140UHY3	0.112	0.100	1.746E-3	661	0.121	0.107	A0A140UHY3.pdb.gz	A0A140UHY3_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=3 SV=1
15	AFDB:A0A0B4J1A5	0.112	0.106	2.091E-3	626	0.117	0.110	A0A0B4J1A5.pdb.gz	A0A0B4J1A5_DANRE EWS RNA-binding protein 1a OS=Danio rerio OX=7955 GN=EWSR1 PE=1 SV=1
16	AFDB:A0A0G2K850	0.103	0.094	2.997E-3	651	0.100	0.091	A0A0G2K850.pdb.gz	A0A0G2K850_RAT EWS RNA-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Ewsr1 PE=1 SV=2
17	AFDB:P78332	0.116	0.066	3.588E-3	1123	0.149	0.078	P78332.pdb.gz	RBM6_HUMAN RNA-binding protein 6 OS=Homo sapiens OX=9606 GN=RBM6 PE=1 SV=5
18	AFDB:Q9VJ12	0.116	0.094	5.143E-3	739	0.104	0.083	Q9VJ12.pdb.gz	Q9VJ12_DROME Acinus, isoform A OS=Drosophila melanogaster OX=7227 GN=Acn PE=1 SV=1
19	AFDB:Q9FFW5	0.096	0.087	6.943E-3	681	0.119	0.103	Q9FFW5.pdb.gz	PERK8_ARATH Proline-rich receptor-like protein kinase PERK8 OS=Arabidopsis thaliana OX=3702 GN=PERK8 PE=1 SV=1
20	AFDB:Q9ZUE0	0.076	0.067	7.828E-3	720	0.141	0.115	Q9ZUE0.pdb.gz	PEK12_ARATH Proline-rich receptor-like protein kinase PERK12 OS=Arabidopsis thaliana OX=3702 GN=PERK12 PE=2 SV=2

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2K3Y6	0.0	674	729	0.572	0.462	A0A0G2K3Y6_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
2	A0A8I5Y6H1	0.0	702	725	0.630	0.512	A0A8I5Y6H1_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=3 SV=1
3	A0A8I5ZK67	0.0	656	726	0.564	0.457	A0A8I5ZK67_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
4	A0A8I6A633	0.0	657	718	0.562	0.461	A0A8I6A633_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
5	A0A8I6GA10	0.0	689	733	0.632	0.508	A0A8I6GA10_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=3 SV=1
6	D3ZHK8	0.0	1182	1022	0.980	0.565	D3ZHK8_RAT Cytoplasmic polyadenylation element binding protein 2 OS=Rattus norvegicus OX=10116 GN=Cpeb2 PE=1 SV=4
7	D3ZKL3	0.0	681	721	0.572	0.467	D3ZKL3_RAT Cytoplasmic polyadenylation element binding protein 4 OS=Rattus norvegicus OX=10116 GN=Cpeb4 PE=1 SV=1
8	D4AD99	0.0	701	756	0.630	0.491	D4AD99_RAT Cytoplasmic polyadenylation element binding protein 3 OS=Rattus norvegicus OX=10116 GN=Cpeb3 PE=1 SV=3
9	Q17RY0	0.0	671	729	0.570	0.461	CPEB4_HUMAN Cytoplasmic polyadenylation element-binding protein 4 OS=Homo sapiens OX=9606 GN=CPEB4 PE=1 SV=1
10	Q28CH2	0.0	702	632	0.679	0.633	CPEB3_XENTR Cytoplasmic polyadenylation element-binding protein 3 OS=Xenopus tropicalis OX=8364 GN=cpeb3 PE=2 SV=1
11	Q5QP71	0.0	711	684	0.632	0.544	Q5QP71_HUMAN Cytoplasmic polyadenylation element binding protein 3, isoform CRA_a OS=Homo sapiens OX=9606 GN=CPEB3 PE=2 SV=1
12	Q7TN98	0.0	672	729	0.570	0.461	CPEB4_MOUSE Cytoplasmic polyadenylation element-binding protein 4 OS=Mus musculus OX=10090 GN=Cpeb4 PE=1 SV=1
13	Q7TN99	0.0	687	716	0.630	0.518	CPEB3_MOUSE Cytoplasmic polyadenylation element-binding protein 3 OS=Mus musculus OX=10090 GN=Cpeb3 PE=1 SV=1
14	Q7Z5Q1	0.0	1218	589	1.000	1.000	CPEB2_HUMAN Cytoplasmic polyadenylation element-binding protein 2 OS=Homo sapiens OX=9606 GN=CPEB2 PE=2 SV=3
15	Q812E0	0.0	1071	521	0.874	0.988	CPEB2_MOUSE Cytoplasmic polyadenylation element-binding protein 2 OS=Mus musculus OX=10090 GN=Cpeb2 PE=1 SV=1
16	Q8NE35	0.0	678	698	0.618	0.521	CPEB3_HUMAN Cytoplasmic polyadenylation element-binding protein 3 OS=Homo sapiens OX=9606 GN=CPEB3 PE=1 SV=2
17	Q9VSR3	1.66e-170	503	704	0.390	0.327	ORB2_DROME Translational regulator orb2 OS=Drosophila melanogaster OX=7227 GN=orb2 PE=1 SV=1
18	Q03571	2.64e-86	281	560	0.219	0.230	CPB1_CAEEL Cytoplasmic polyadenylation element-binding protein 1 OS=Caenorhabditis elegans OX=6239 GN=cpb-1 PE=1 SV=3
19	A0A087X171	1.01e-62	218	561	0.202	0.212	A0A087X171_HUMAN Cytoplasmic polyadenylation element-binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1
20	A0A087WXG7	1.55e-62	218	588	0.202	0.202	A0A087WXG7_HUMAN Cytoplasmic polyadenylation element binding protein 1 OS=Homo sapiens OX=9606 GN=CPEB1 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16366 CEBP_ZZ	1.7e-17	74.7	Cytoplasmic polyadenylation element-binding protein ZZ domain
2	PF00011 HSP20	7.6e+02	11.7	Hsp20/alpha crystallin family
3	PF00076 RRM_1	5.7e-09	47.0	RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
4	PF16367 RRM_7	9.1e-33	123.6	RNA recognition motif
5	PF00643 zf-B_box	7.1e+02	11.8	B-box zinc finger
6	PF06220 zf-U1	3.4e+02	12.4	U1 zinc finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9541.XP_005555378.1

Rank	PPI partner	STRING score	Description
1	9541.XP_005569450.1	0.883	Serine/threonine-protein kinase 6
2	9541.XP_005575426.1	0.805	Serine/threonine-protein kinase PLK1
3	9541.XP_005587597.1	0.700	Eukaryotic translation elongation factor 2
4	9541.XP_005582826.1	0.687	Fragile X mental retardation syndrome-related protein 2 isoform X1
5	9541.XP_005546531.1	0.658	FMR1 autosomal homolog 1
6	9541.XP_005559729.1	0.648	Essential for the control of the cell cycle at the G2/M (mitosis) transition
7	9541.XP_005557913.1	0.625	Cyclin-dependent kinase 1-like isoform X1
8	9541.XP_005565839.1	0.625	Uncharacterized protein
9	9541.XP_005558381.1	0.557	Ras GTPase-activating protein-binding protein 1 isoform X1
10	9541.XP_005572323.1	0.540	Uncharacterized protein
11	9541.XP_005583789.1	0.540	Uncharacterized protein
12	9541.XP_005567204.1	0.529	Protein Tob2
13	9541.XP_005546804.1	0.526	Uncharacterized protein
14	9541.XP_005557309.1	0.502	poly(A) RNA polymerase GLD2 isoform X1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.997	protein binding
GO:0003723	0.997	RNA binding
GO:0090079	0.990	translation regulator activity, nucleic acid binding
GO:0000900	0.971	mRNA regulatory element binding translation repressor activity
GO:0003729	0.950	mRNA binding
GO:0003730	0.737	mRNA 3'-UTR binding
GO:0043021	0.632	ribonucleoprotein complex binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0048519	0.946	negative regulation of biological process
GO:0009987	0.940	cellular process
GO:0050794	0.926	regulation of cellular process
GO:0009892	0.919	negative regulation of metabolic process
GO:0010468	0.913	regulation of gene expression
GO:0051171	0.901	regulation of nitrogen compound metabolic process
GO:0031323	0.901	regulation of cellular metabolic process
GO:0009889	0.890	regulation of biosynthetic process
GO:0080090	0.886	regulation of primary metabolic process
GO:0017148	0.881	negative regulation of translation
GO:0071456	0.857	cellular response to hypoxia
GO:2000765	0.648	regulation of cytoplasmic translation
GO:0009719	0.523	response to endogenous stimulus
GO:1901698	0.500	response to nitrogen compound

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0005634	0.999	nucleus
GO:0032991	0.975	protein-containing complex
GO:0045202	0.691	synapse
GO:0043233	0.471	organelle lumen
GO:0070013	0.463	intracellular organelle lumen
GO:0031981	0.375	nuclear lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]