StarFunc result for job id Q7Z5W3

User Input

>input (292 residues)
MAVPTELDGGSVKETAAEEESRVLAPGAAPFGNFPHYSRFHPPEQRLRLLPPELLRQLFP
ESPENGPILGLDVGCNSGDLSVALYKHFLSLPDGETCSDASREFRLLCCDIDPVLVKRAE
KECPFPDALTFITLDFMNQRTRKVLLSSFLSQFGRSVFDIGFCMSITMWIHLNHGDHGLW
EFLAHLSSLCHYLLVEPQPWKCYRAAARRLRKLGLHDFDHFHSLAIRGDMPNQIVQILTQ
DHGMELICCFGNTSWDRSLLLFRAKQTIETHPIPESLIEKGKEKNRLSFQKQ

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z5W3	1.000	1.000	4.705E-64	292	1.000	1.000	Q7Z5W3.pdb.gz	BN3D2_HUMAN RNA 5'-monophosphate methyltransferase OS=Homo sapiens OX=9606 GN=BCDIN3D PE=1 SV=1
2	PDB:6l8uC	0.760	0.966	3.226E-40	229	0.781	0.996	6l8uC.pdb.gz	Crystal structure of human cytoplasmic tRNAHis-specific 5'-monomethylphosphate capping enzyme.
3	AFDB:Q7L2J0	0.554	0.252	5.462E-13	689	0.236	0.100	Q7L2J0.pdb.gz	MEPCE_HUMAN 7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1
4	AFDB:Q9Y7L2	0.561	0.608	1.155E-12	268	0.226	0.246	Q9Y7L2.pdb.gz	BIN3D_SCHPO Probable RNA methyltransferase C2A9.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2A9.10 PE=3 SV=1
5	AFDB:Q8K3A9	0.554	0.259	1.483E-12	666	0.247	0.108	Q8K3A9.pdb.gz	MEPCE_MOUSE 7SK snRNA methylphosphate capping enzyme OS=Mus musculus OX=10090 GN=Mepce PE=1 SV=2
6	AFDB:Q7K480	0.595	0.141	5.571E-10	1367	0.195	0.042	Q7K480.pdb.gz	MEPCE_DROME 7SK snRNA methylphosphate capping enzyme bin3 OS=Drosophila melanogaster OX=7227 GN=bin3 PE=1 SV=1
7	PDB:1tw2B	0.421	0.357	1.009E-8	350	0.123	0.103	1tw2B.pdb.gz	Crystal structure of a ternary complex of DnrK, a methyltransferase in daunorubicin biosynthesis, with bound products
8	AFDB:Q9SW18	0.422	0.398	6.807E-8	312	0.158	0.147	Q9SW18.pdb.gz	CHLM_ARATH Magnesium protoporphyrin IX methyltransferase, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=CHLM PE=1 SV=1
9	PDB:1qzzA	0.429	0.374	1.573E-7	340	0.123	0.106	1qzzA.pdb.gz	Crystal Structure of Aclacinomycin-10-Hydroxylase, a S-Adenosyl-L-Methionine-dependent Methyltransferase Homolog Involved in Anthracycline Biosynthesis in Streptomyces purpurascens.
10	AFDB:O53979	0.428	0.441	1.631E-7	282	0.120	0.124	O53979.pdb.gz	O53979_MYCTU Conserved protein OS=Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) OX=83332 GN=Rv1978 PE=1 SV=3
11	AFDB:O18235	0.441	0.475	1.848E-7	268	0.123	0.134	O18235.pdb.gz	O18235_CAEEL Ubiquinone biosynthesis O-methyltransferase, mitochondrial OS=Caenorhabditis elegans OX=6239 GN=coq-3 PE=1 SV=1
12	AFDB:O25150	0.477	0.562	1.848E-7	243	0.106	0.128	O25150.pdb.gz	CMOA_HELPY Carboxy-S-adenosyl-L-methionine synthase OS=Helicobacter pylori (strain ATCC 700392 / 26695) OX=85962 GN=cmoA PE=3 SV=1
13	PDB:2ip2A	0.417	0.375	2.434E-7	330	0.110	0.097	2ip2A.pdb.gz
14	PDB:3htxD	0.457	0.185	2.935E-7	795	0.144	0.053	3htxD.pdb.gz	Structural insights into mechanisms of the small RNA methyltransferase HEN1.
15	PDB:4a6dA	0.420	0.364	3.125E-7	345	0.134	0.113	4a6dA.pdb.gz	Crystal Structure and Functional Mapping of Human Asmt, the Last Enzyme of the Melatonin Synthesis Pathway.
16	AFDB:Q57XQ9	0.431	0.488	4.159E-7	254	0.134	0.154	Q57XQ9.pdb.gz	Q57XQ9_TRYB2 Methyltransferase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb07.21H15.580 PE=4 SV=1
17	PDB:3gwzA	0.416	0.363	7.033E-7	339	0.092	0.080	3gwzA.pdb.gz	Structural characterization of the mitomycin 7-O-methyltransferase.
18	PDB:3i58A	0.426	0.384	1.794E-6	328	0.086	0.076	3i58A.pdb.gz	Molecular basis of substrate promiscuity for the SAM-dependent O-methyltransferase NcsB1, involved in the biosynthesis of the enediyne antitumor antibiotic neocarzinostatin.
19	PDB:4kdcA	0.394	0.505	3.145E-6	217	0.082	0.111	4kdcA.pdb.gz
20	PDB:4hh4C	0.449	0.506	5.516E-6	256	0.120	0.137	4hh4C.pdb.gz	Structure and possible mechanism of the CcbJ methyltransferase from Streptomyces caelestis.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z5W3	0.0	603	292	1.000	1.000	BN3D2_HUMAN RNA 5'-monophosphate methyltransferase OS=Homo sapiens OX=9606 GN=BCDIN3D PE=1 SV=1
2	Q9Y7L2	9.37e-09	57.4	268	0.147	0.160	BIN3D_SCHPO Probable RNA methyltransferase C2A9.10 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC2A9.10 PE=3 SV=1
3	Q7L2J0	4.07e-08	56.6	689	0.236	0.100	MEPCE_HUMAN 7SK snRNA methylphosphate capping enzyme OS=Homo sapiens OX=9606 GN=MEPCE PE=1 SV=1
4	Q8K3A9	7.43e-07	52.8	666	0.137	0.060	MEPCE_MOUSE 7SK snRNA methylphosphate capping enzyme OS=Mus musculus OX=10090 GN=Mepce PE=1 SV=2
5	Q7K480	0.004	41.2	1367	0.082	0.018	MEPCE_DROME 7SK snRNA methylphosphate capping enzyme bin3 OS=Drosophila melanogaster OX=7227 GN=bin3 PE=1 SV=1
6	Q9VPL5	1.1	33.5	715	0.089	0.036	Q9VPL5_DROME LD27216p OS=Drosophila melanogaster OX=7227 GN=Tbc1d15-17 PE=1 SV=1
7	O36025	1.2	33.1	992	0.079	0.023	MPD2_SCHPO GYF domain-containing protein mpd2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mpd2 PE=1 SV=1
8	Q69ZK0	2.2	32.3	1650	0.051	0.009	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2
9	Q90880	6.4	30.8	626	0.062	0.029	Q90880_CHICK L-gicerin OS=Gallus gallus OX=9031 PE=2 SV=1
10	Q90989	6.8	30.8	584	0.062	0.031	Q90989_CHICK S-gicerin OS=Gallus gallus OX=9031 PE=2 SV=1
11	Q96AA3	6.9	30.8	541	0.072	0.039	RFT1_HUMAN Protein RFT1 homolog OS=Homo sapiens OX=9606 GN=RFT1 PE=1 SV=1
12	D3ZS72	8.8	30.4	1635	0.051	0.009	D3ZS72_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=1 SV=4
13	A0A8I6GLR6	9.1	30.4	1646	0.051	0.009	A0A8I6GLR6_RAT Phosphatidylinositol-3,4,5-trisphosphate-dependent Rac exchange factor 1 OS=Rattus norvegicus OX=10116 GN=Prex1 PE=4 SV=1
14	Q8MKW7	9.6	30.4	766	0.068	0.026	RNZ_DROME Ribonuclease Z, mitochondrial OS=Drosophila melanogaster OX=7227 GN=RNaseZ PE=2 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF06859 Bin3	6e-16	70.4	Bicoid-interacting protein 3 (Bin3)
2	PF08241 Methyltransf_11	33	16.5	Methyltransferase domain
3	PF08242 Methyltransf_12	5.5	19.1	Methyltransferase domain
4	PF13649 Methyltransf_25	10	18.2	Methyltransferase domain
5	PF13847 Methyltransf_31	2	19.6	Methyltransferase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000335201

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000295448	0.687	Glucosamine-6-phosphate deaminase 2
2	9606.ENSP00000308339	0.687	Protein transport protein Sec16B
3	9606.ENSP00000394390	0.682	BTB/POZ domain-containing protein KCTD15
4	9606.ENSP00000281017	0.660	Transmembrane protein 18
5	9606.ENSP00000314441	0.658	tRNA (guanine-N(7)-)-methyltransferase
6	9606.ENSP00000321951	0.655	Protein lifeguard 2
7	9606.ENSP00000303222	0.634	Mitochondrial carrier homolog 2
8	9606.ENSP00000321221	0.617	SH2B adapter protein 1
9	9606.ENSP00000350364	0.600	Neuronal growth regulator 1
10	9606.ENSP00000298717	0.591	N6-adenosine-methyltransferase catalytic subunit
11	9606.ENSP00000363135	0.585	Uncharacterized protein C6orf106
12	9606.ENSP00000372804	0.559	mRNA cap guanine-N7 methyltransferase
13	9606.ENSP00000276416	0.536	Bridging integrator 3
14	9606.ENSP00000263092	0.527	U6 small nuclear RNA (adenine-(43)-N(6))-methyltransferase
15	9606.ENSP00000322251	0.525	Serine/threonine-protein kinase TNNI3K
16	9606.ENSP00000418823	0.519	Alpha-ketoglutarate-dependent dioxygenase FTO
17	9606.ENSP00000299766	0.517	Melanocortin receptor 4
18	9606.ENSP00000389275	0.517	LOC339047 protein
19	9606.ENSP00000433597	0.517	Nuclear pore complex interacting protein family member A5
20	9606.ENSP00000012049	0.514	Glutaminyl-peptide cyclotransferase-like protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0070883	1.000	pre-miRNA binding
GO:0008175	1.000	tRNA methyltransferase activity
GO:0090486	1.000	small RNA 2'-O-methyltransferase activity
GO:0008757	0.387	S-adenosylmethionine-dependent methyltransferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0034470	0.996	ncRNA processing
GO:0009451	0.991	RNA modification
GO:0048519	0.986	negative regulation of biological process
GO:0010468	0.985	regulation of gene expression
GO:0051171	0.984	regulation of nitrogen compound metabolic process
GO:0043414	0.983	macromolecule methylation
GO:0031047	0.979	RNA-mediated gene silencing
GO:0006400	0.979	tRNA modification
GO:0001510	0.974	RNA methylation
GO:0019219	0.971	regulation of nucleobase-containing compound metabolic process
GO:0060964	0.966	regulation of miRNA-mediated gene silencing
GO:0070918	0.944	regulatory ncRNA processing
GO:0051252	0.938	regulation of RNA metabolic process
GO:0035196	0.920	miRNA processing
GO:0070920	0.888	regulation of production of small RNA involved in gene silencing by RNA
GO:0048518	0.866	positive regulation of biological process
GO:0048523	0.836	negative regulation of cellular process
GO:0010604	0.640	positive regulation of macromolecule metabolic process
GO:0030488	0.634	tRNA methylation
GO:0031324	0.541	negative regulation of cellular metabolic process
GO:0051172	0.539	negative regulation of nitrogen compound metabolic process
GO:0045934	0.508	negative regulation of nucleobase-containing compound metabolic process
GO:0051253	0.453	negative regulation of RNA metabolic process
GO:0010628	0.415	positive regulation of gene expression
GO:0010586	0.389	miRNA metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0005654	0.998	nucleoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
RHEA:37887	1.000	S-adenosyl-L-methionine + small RNA 3'-end nucleotide = H(+) + S-adenosyl-L-homocysteine + small RNA 3'-end 2'-O-methylnucleotide
EC:2.1.1.n8	1.000	Transferred entry: 2.1.1.386.

[back to server]