StarFunc result for job id Q7Z5Y6

User Input

>input (402 residues)
MAARPGPLWLLGLTLCALGGGGPGLRPPPGCPQRRLGARERRDVQREILAVLGLPGRPRP
RAPPAASRLPASAPLFMLDLYHAMAGDDDEDGAPAEQRLGRADLVMSFVNMVERDRALGH
QEPHWKEFRFDLTQIPAGEAVTAAEFRIYKVPSIHLLNRTLHVSMFQVVQEQSNRESDLF
FLDLQTLRAGDEGWLVLDVTAASDCWLLKRHKDLGLRLYVETEDGHSVDPGLAGLLGQRA
PRSQQPFVVTFFRASPSPIRTPRAVRPLRRRQPKKSNELPQANRLPGIFDDVRGSHGRQV
CRRHELYVSFQDLGWLDWVIAPQGYSAYYCEGECSFPLDSCMNATNHAILQSLVHLMKPN
AVPKACCAPTKLSATSVLYYDSSNNVILRKHRNMVVKACGCH

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P34820	0.964	0.964	4.121E-75	402	0.983	0.983	P34820.pdb.gz	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
2	AFDB:P34821	0.906	0.913	3.915E-67	399	0.856	0.862	P34821.pdb.gz	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
3	AFDB:P55105	0.864	0.870	3.336E-61	399	0.741	0.747	P55105.pdb.gz	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
4	AFDB:A8K571	0.794	0.743	6.778E-49	431	0.527	0.492	A8K571.pdb.gz	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
5	AFDB:F1P4H2	0.833	0.774	1.371E-48	434	0.532	0.493	F1P4H2.pdb.gz
6	AFDB:F1NUT2	0.821	0.714	1.898E-48	465	0.527	0.456	F1NUT2.pdb.gz
7	AFDB:A0A0R4ILD5	0.798	0.723	5.922E-48	446	0.530	0.478	A0A0R4ILD5.pdb.gz
8	AFDB:P22004	0.767	0.607	1.106E-44	513	0.525	0.411	P22004.pdb.gz	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
9	AFDB:Q9PTF9	0.757	0.708	2.704E-43	432	0.465	0.433	Q9PTF9.pdb.gz	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
10	AFDB:D4A7P9	0.395	0.517	1.022E-37	302	0.413	0.550	D4A7P9.pdb.gz	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
11	PDB:5hlyA	0.275	0.354	3.423E-16	299	0.216	0.291	5hlyA.pdb.gz
12	PDB:5ntuA	0.271	0.346	5.002E-16	308	0.197	0.256	5ntuA.pdb.gz
13	PDB:3rjrC	0.278	0.320	1.479E-15	343	0.214	0.251	3rjrC.pdb.gz
14	PDB:5vqfB	0.290	0.355	7.117E-15	320	0.197	0.247	5vqfB.pdb.gz
15	PDB:6umxA	0.312	0.421	9.592E-14	279	0.189	0.272	6umxA.pdb.gz
16	PDB:5nxsA	0.249	0.336	1.069E-13	290	0.194	0.269	5nxsA.pdb.gz
17	PDB:5ffoG	0.309	0.402	1.041E-12	297	0.204	0.276	5ffoG.pdb.gz	Force interacts with macromolecular structure in activation of TGF-beta.
18	PDB:7y1rB	0.266	0.337	1.994E-12	308	0.194	0.253	7y1rB.pdb.gz
19	PDB:5nxsB	0.244	0.375	5.588E-10	251	0.182	0.291	5nxsB.pdb.gz
20	PDB:6q2sA	0.158	0.527	2.923E-4	98	0.065	0.265	6q2sA.pdb.gz	Cryo-EM analyses reveal the common mechanism and diversification in the activation of RET by different ligands.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	P34820	0.0	810	402	0.983	0.983	BMP8B_HUMAN Bone morphogenetic protein 8B OS=Homo sapiens OX=9606 GN=BMP8B PE=2 SV=2
2	P34821	0.0	645	399	0.856	0.862	BMP8A_MOUSE Bone morphogenetic protein 8A OS=Mus musculus OX=10090 GN=Bmp8a PE=2 SV=1
3	P55105	0.0	596	399	0.741	0.747	BMP8B_MOUSE Bone morphogenetic protein 8B OS=Mus musculus OX=10090 GN=Bmp8b PE=1 SV=2
4	Q7Z5Y6	0.0	824	402	1.000	1.000	BMP8A_HUMAN Bone morphogenetic protein 8A OS=Homo sapiens OX=9606 GN=BMP8A PE=2 SV=2
5	P49003	8.05e-143	416	452	0.520	0.462	BMP5_MOUSE Bone morphogenetic protein 5 OS=Mus musculus OX=10090 GN=Bmp5 PE=1 SV=1
6	D4A7P9	5.36e-142	414	454	0.530	0.469	D4A7P9_RAT Bone morphogenetic protein 5 OS=Rattus norvegicus OX=10116 GN=Bmp5 PE=3 SV=3
7	P22003	2.41e-141	412	454	0.522	0.463	BMP5_HUMAN Bone morphogenetic protein 5 OS=Homo sapiens OX=9606 GN=BMP5 PE=1 SV=1
8	G3V6W8	1.59e-139	406	430	0.507	0.474	G3V6W8_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1
9	P23359	1.59e-139	406	430	0.507	0.474	BMP7_MOUSE Bone morphogenetic protein 7 OS=Mus musculus OX=10090 GN=Bmp7 PE=1 SV=2
10	A8K571	4.34e-139	405	431	0.510	0.476	A8K571_HUMAN Bone morphogenetic protein 7 (Osteogenic protein 1), isoform CRA_b OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
11	P18075	4.34e-139	405	431	0.510	0.476	BMP7_HUMAN Bone morphogenetic protein 7 OS=Homo sapiens OX=9606 GN=BMP7 PE=1 SV=1
12	Q7T288	8.23e-139	405	446	0.515	0.464	Q7T288_DANRE Bone morphogenetic protein 5 OS=Danio rerio OX=7955 GN=bmp5l PE=2 SV=1
13	Q9I8T6	2.34e-136	397	398	0.502	0.508	Q9I8T6_CHICK Bone morphogenetic protein 7 (Fragment) OS=Gallus gallus OX=9031 GN=BMP7 PE=2 SV=1
14	P20722	1.02e-123	369	510	0.520	0.410	BMP6_MOUSE Bone morphogenetic protein 6 OS=Mus musculus OX=10090 GN=Bmp6 PE=1 SV=2
15	Q04906	1.47e-122	366	506	0.510	0.405	BMP6_RAT Bone morphogenetic protein 6 OS=Rattus norvegicus OX=10116 GN=Bmp6 PE=2 SV=2
16	P22004	2.41e-122	365	513	0.507	0.398	BMP6_HUMAN Bone morphogenetic protein 6 OS=Homo sapiens OX=9606 GN=BMP6 PE=1 SV=1
17	Q9PTF9	1.36e-121	361	432	0.483	0.449	Q9PTF9_DANRE Bone morphogenetic protein 7 OS=Danio rerio OX=7955 GN=Bmp7 PE=2 SV=1
18	Q9R228	1.22e-110	328	306	0.391	0.513	Q9R228_RAT Bone morphogenetic protein 7 (Fragment) OS=Rattus norvegicus OX=10116 PE=2 SV=1
19	P27091	6.92e-64	213	455	0.348	0.308	60A_DROME Protein 60A OS=Drosophila melanogaster OX=7227 GN=gbb PE=1 SV=1
20	A0A8I6A920	1.11e-55	189	364	0.197	0.217	A0A8I6A920_RAT Bone morphogenetic protein 7 OS=Rattus norvegicus OX=10116 GN=Bmp7 PE=3 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00688 TGFb_propeptide	1.8e-58	209.6	TGF-beta propeptide
2	PF00019 TGF_beta	6e-35	131.6	Transforming growth factor beta like domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000327440

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000401907	0.888	Bone morphogenetic protein receptor type-1B
2	9606.ENSP00000363708	0.886	Bone morphogenetic protein receptor type-2
3	9606.ENSP00000241416	0.882	Activin receptor type-2A
4	9606.ENSP00000361107	0.882	Bone morphogenetic protein receptor type-1A
5	9606.ENSP00000263640	0.881	Activin receptor type-1
6	9606.ENSP00000340361	0.878	Activin receptor type-2B
7	9606.ENSP00000361915	0.800	Bone morphogenetic protein 8B
8	9606.ENSP00000204604	0.745	Chordin
9	9606.ENSP00000478319	0.669	Gremlin-1
10	9606.ENSP00000257863	0.668	Anti-Muellerian hormone type-2 receptor
11	9606.ENSP00000328181	0.667	Noggin
12	9606.ENSP00000318650	0.646	Gremlin-2
13	9606.ENSP00000458832	0.646	Arachidonate 15-lipoxygenase
14	9606.ENSP00000289749	0.628	Neuroblastoma suppressor of tumorigenicity 1
15	9606.ENSP00000235345	0.557	UDP-glucuronic acid/UDP-N-acetylgalactosamine transporter
16	9606.ENSP00000418734	0.550	Histone H2A deubiquitinase MYSM1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0048018	0.998	receptor ligand activity
GO:0005125	0.991	cytokine activity
GO:0042802	0.724	identical protein binding
GO:0046983	0.333	protein dimerization activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0032502	0.991	developmental process
GO:0050896	0.988	response to stimulus
GO:0032501	0.988	multicellular organismal process
GO:0050794	0.987	regulation of cellular process
GO:0009987	0.983	cellular process
GO:0048856	0.977	anatomical structure development
GO:0007275	0.960	multicellular organism development
GO:0051716	0.941	cellular response to stimulus
GO:0023051	0.937	regulation of signaling
GO:0010646	0.937	regulation of cell communication
GO:0048518	0.915	positive regulation of biological process
GO:0070848	0.887	response to growth factor
GO:0048731	0.885	system development
GO:0048519	0.848	negative regulation of biological process
GO:0001501	0.836	skeletal system development
GO:0048522	0.833	positive regulation of cellular process
GO:0023052	0.787	signaling
GO:0007154	0.754	cell communication
GO:0007167	0.726	enzyme-linked receptor protein signaling pathway
GO:0019222	0.724	regulation of metabolic process
GO:0060255	0.692	regulation of macromolecule metabolic process
GO:0031323	0.690	regulation of cellular metabolic process
GO:0065008	0.687	regulation of biological quality
GO:0051046	0.676	regulation of secretion
GO:0048523	0.661	negative regulation of cellular process
GO:0010817	0.656	regulation of hormone levels
GO:0046883	0.643	regulation of hormone secretion
GO:0048583	0.607	regulation of response to stimulus
GO:0007178	0.604	transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071495	0.602	cellular response to endogenous stimulus
GO:0009966	0.596	regulation of signal transduction
GO:0080090	0.588	regulation of primary metabolic process
GO:0051171	0.588	regulation of nitrogen compound metabolic process
GO:0071363	0.587	cellular response to growth factor stimulus
GO:0050793	0.558	regulation of developmental process
GO:0002021	0.531	response to dietary excess
GO:0008152	0.527	metabolic process
GO:0090092	0.499	regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0071773	0.443	cellular response to BMP stimulus
GO:0009893	0.434	positive regulation of metabolic process
GO:0051239	0.433	regulation of multicellular organismal process
GO:0030509	0.431	BMP signaling pathway
GO:0023057	0.416	negative regulation of signaling
GO:0010648	0.416	negative regulation of cell communication
GO:0010468	0.415	regulation of gene expression
GO:0010604	0.414	positive regulation of macromolecule metabolic process
GO:0060393	0.412	regulation of pathway-restricted SMAD protein phosphorylation
GO:0051173	0.405	positive regulation of nitrogen compound metabolic process
GO:0048513	0.404	animal organ development
GO:0071704	0.393	organic substance metabolic process
GO:0010647	0.391	positive regulation of cell communication
GO:0023056	0.390	positive regulation of signaling
GO:0051240	0.381	positive regulation of multicellular organismal process
GO:0045595	0.368	regulation of cell differentiation
GO:0031325	0.367	positive regulation of cellular metabolic process
GO:0009889	0.366	regulation of biosynthetic process
GO:0010556	0.364	regulation of macromolecule biosynthetic process
GO:0031326	0.364	regulation of cellular biosynthetic process
GO:0019219	0.363	regulation of nucleobase-containing compound metabolic process
GO:0090100	0.356	positive regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0006355	0.350	regulation of DNA-templated transcription
GO:2000026	0.345	regulation of multicellular organismal development
GO:0010557	0.327	positive regulation of macromolecule biosynthetic process
GO:0031328	0.327	positive regulation of cellular biosynthetic process
GO:0051094	0.324	positive regulation of developmental process
GO:0045667	0.320	regulation of osteoblast differentiation
GO:0044237	0.319	cellular metabolic process
GO:0045935	0.317	positive regulation of nucleobase-containing compound metabolic process
GO:0000003	0.314	reproduction
GO:0006357	0.300	regulation of transcription by RNA polymerase II

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005576	0.999	extracellular region
GO:0071944	0.993	cell periphery
GO:0005886	0.903	plasma membrane
GO:0005615	0.774	extracellular space
GO:0043226	0.454	organelle
GO:0043227	0.420	membrane-bounded organelle
GO:0005622	0.392	intracellular anatomical structure

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]