StarFunc result for job id Q7Z5Y7

User Input

>input (419 residues)
MNVHRGSDSDRLLRQEASCLVDDTLAVAQEKEANSLASSGPHNLTYPLGPRNEDLSLDYA
SQPANLQFPHIMPLAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVT
LLVDGTRFVVNPQIFTAHPDTMLGRMFGPGREYNFTRPNEKGEYEIAEGISATVFRTVLD
YYKTGIINCPDGISIPDLRDTCDYLCINFDFNTIRCQDLSALLHELSNDGAHKQFDHYLE
ELILPIMVGCAKKGERECHIVVLTDEDSVDWDEDHPPPMGEEYSQILYSSKLYRFFKYIE
NRDVAKTVLKERGLKNIRIGIEGYPTCKEKIKRRPGGRSEVIYNYVQRPFIQMSWEKEEG
KSRHVDFQCVRSKSLTNLVAAGDDVLEDQEILMHHPPQVDELDRLNAPLSQMASNDFQD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q8CDD8	0.647	0.647	2.894E-71	419	0.907	0.907	Q8CDD8.pdb.gz	KCD20_MOUSE BTB/POZ domain-containing protein KCTD20 OS=Mus musculus OX=10090 GN=Kctd20 PE=1 SV=1
2	AFDB:D3DQW7	0.601	0.531	2.092E-50	475	0.585	0.516	D3DQW7.pdb.gz	D3DQW7_HUMAN BTB (POZ) domain containing 10, isoform CRA_a OS=Homo sapiens OX=9606 GN=BTBD10 PE=2 SV=1
3	AFDB:Q0E8K5	0.616	0.589	2.434E-42	439	0.442	0.421	Q0E8K5.pdb.gz	Q0E8K5_DROME AT10158p OS=Drosophila melanogaster OX=7227 GN=mri PE=1 SV=1
4	PDB:7phhA	0.236	0.249	1.381E-7	396	0.057	0.061	7phhA.pdb.gz
5	PDB:7w6sB	0.237	0.223	2.888E-7	448	0.069	0.065	7w6sB.pdb.gz
6	AFDB:Q14681	0.223	0.336	1.245E-6	263	0.103	0.163	Q14681.pdb.gz	KCTD2_HUMAN BTB/POZ domain-containing protein KCTD2 OS=Homo sapiens OX=9606 GN=KCTD2 PE=1 SV=3
7	AFDB:Q54EU5	0.207	0.180	6.964E-6	488	0.055	0.047	Q54EU5.pdb.gz	Q54EU5_DICDI BTB/POZ domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=kctd9 PE=4 SV=1
8	PDB:7pquA	0.230	0.289	7.518E-6	328	0.069	0.088	7pquA.pdb.gz
9	PDB:7f3fA	0.227	0.208	9.615E-6	460	0.067	0.061	7f3fA.pdb.gz
10	PDB:7sizB	0.204	0.252	1.391E-5	334	0.053	0.066	7sizB.pdb.gz	Structural basis for C-type inactivation in a Shaker family voltage-gated K + channel.
11	AFDB:P17970	0.243	0.112	1.457E-5	985	0.110	0.047	P17970.pdb.gz	KCNAB_DROME Potassium voltage-gated channel protein Shab OS=Drosophila melanogaster OX=7227 GN=Shab PE=1 SV=2
12	AFDB:Q16322	0.203	0.168	2.694E-5	511	0.069	0.057	Q16322.pdb.gz	KCA10_HUMAN Potassium voltage-gated channel subfamily A member 10 OS=Homo sapiens OX=9606 GN=KCNA10 PE=1 SV=2
13	PDB:2a79B	0.193	0.305	3.498E-5	259	0.041	0.066	2a79B.pdb.gz	Crystal structure of a mammalian voltage-dependent Shaker family K+ channel.
14	PDB:3lutB	0.185	0.198	1.125E-4	390	0.043	0.046	3lutB.pdb.gz	Structure of the full-length Shaker potassium channel Kv1.2 by normal-mode-based X-ray crystallographic refinement.
15	PDB:7sszA	0.191	0.219	1.628E-4	362	0.048	0.055	7sszA.pdb.gz
16	PDB:6sgaFS	0.184	0.267	1.030E-3	277	0.091	0.137	6sgaFS.pdb.gz	Mitoribosomal small subunit biogenesis in trypanosomes involves an extensive assembly machinery.
17	PDB:7abzS	0.068	0.170	1.639E-2	110	0.031	0.118	7abzS.pdb.gz	Structures of tmRNA and SmpB as they transit through the ribosome.
18	AFDB:Q8BYM7	0.080	0.056	1.155E-1	716	0.138	0.081	Q8BYM7.pdb.gz	RSH4A_MOUSE Radial spoke head protein 4 homolog A OS=Mus musculus OX=10090 GN=Rsph4a PE=1 SV=2
19	AFDB:O43290	0.089	0.055	6.465E-1	800	0.129	0.068	O43290.pdb.gz	SNUT1_HUMAN U4/U6.U5 tri-snRNP-associated protein 1 OS=Homo sapiens OX=9606 GN=SART1 PE=1 SV=1
20	AFDB:P36027	0.085	0.083	6.465E-1	376	0.107	0.120	P36027.pdb.gz	MID2_YEAST Cell wall integrity sensor MID2 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MID2 PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q8CDD8	0.0	780	419	0.907	0.907	KCD20_MOUSE BTB/POZ domain-containing protein KCTD20 OS=Mus musculus OX=10090 GN=Kctd20 PE=1 SV=1
2	Q5EAP0	3.43e-165	472	427	0.537	0.527	Q5EAP0_RAT BTB (POZ) domain containing 10 OS=Rattus norvegicus OX=10116 GN=Btbd10 PE=2 SV=1
3	Q80X66	5.54e-164	471	475	0.537	0.474	BTBDA_MOUSE BTB/POZ domain-containing protein 10 OS=Mus musculus OX=10090 GN=Btbd10 PE=1 SV=1
4	D3DQW7	8.48e-164	471	475	0.537	0.474	D3DQW7_HUMAN BTB (POZ) domain containing 10, isoform CRA_a OS=Homo sapiens OX=9606 GN=BTBD10 PE=2 SV=1
5	Q9BSF8	8.48e-164	471	475	0.537	0.474	BTBDA_HUMAN BTB/POZ domain-containing protein 10 OS=Homo sapiens OX=9606 GN=BTBD10 PE=1 SV=2
6	Q0E8K5	9.29e-134	393	439	0.420	0.401	Q0E8K5_DROME AT10158p OS=Drosophila melanogaster OX=7227 GN=mri PE=1 SV=1
7	X2J8G3	8.45e-133	390	438	0.422	0.404	X2J8G3_DROME Mrityu, isoform E OS=Drosophila melanogaster OX=7227 GN=mri PE=1 SV=1
8	Q8SXB5	1.33e-69	221	216	0.236	0.458	Q8SXB5_DROME GH10911p OS=Drosophila melanogaster OX=7227 GN=mri PE=2 SV=1
9	D3ZYK3	0.035	38.9	650	0.062	0.040	D3ZYK3_RAT Potassium voltage-gated channel, Shal-related family, member 1 OS=Rattus norvegicus OX=10116 GN=Kcnd1 PE=4 SV=1
10	Q9NSA2	0.082	37.7	647	0.060	0.039	KCND1_HUMAN Potassium voltage-gated channel subfamily D member 1 OS=Homo sapiens OX=9606 GN=KCND1 PE=1 SV=2
11	Q7ZW36	0.21	36.2	638	0.062	0.041	Q7ZW36_DANRE Potassium voltage-gated channel subfamily D member 3 precursor OS=Danio rerio OX=7955 GN=wu:fi06g01 PE=2 SV=1
12	A0A286Y962	0.23	36.2	650	0.062	0.040	A0A286Y962_DANRE Potassium voltage-gated channel subfamily D member 3 isoform X1 OS=Danio rerio OX=7955 GN=wu:fi06g01 PE=4 SV=1
13	Q9VDH3	0.34	35.0	228	0.048	0.088	Q9VDH3_DROME GH08630p OS=Drosophila melanogaster OX=7227 GN=Ktl PE=1 SV=1
14	Q4G0X4	0.70	34.3	260	0.050	0.081	KCD21_HUMAN BTB/POZ domain-containing protein KCTD21 OS=Homo sapiens OX=9606 GN=KCTD21 PE=1 SV=1
15	P14426	0.76	34.3	362	0.069	0.080	HA13_MOUSE H-2 class I histocompatibility antigen, D-K alpha chain OS=Mus musculus OX=10090 GN=H2-D1 PE=1 SV=1
16	Q9XEX2	0.76	33.5	162	0.060	0.154	PRX2B_ARATH Peroxiredoxin-2B OS=Arabidopsis thaliana OX=3702 GN=PRXIIB PE=1 SV=1
17	P14428	0.84	34.3	328	0.038	0.049	HA1Q_MOUSE H-2 class I histocompatibility antigen, K-Q alpha chain (Fragment) OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
18	P03991	0.91	34.3	368	0.038	0.043	HA1W_MOUSE H-2 class I histocompatibility antigen, K-W28 alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=2
19	P01901	0.96	33.9	369	0.064	0.073	HA1B_MOUSE H-2 class I histocompatibility antigen, K-B alpha chain OS=Mus musculus OX=10090 GN=H2-K1 PE=1 SV=1
20	P17971	2.0	33.1	571	0.055	0.040	KCNAL_DROME Potassium voltage-gated channel protein Shal OS=Drosophila melanogaster OX=7227 GN=Shal PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02214 BTB_2	0.12	24.0	BTB/POZ domain
2	PF16017 BTB_3	8.3e-49	175.3	BTB/POZ domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000362836

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000305702	0.762	BTB/POZ domain-containing protein KCTD19
2	9606.ENSP00000360757	0.632	Protein FAM69B
3	9606.ENSP00000352941	0.624	BTB/POZ domain-containing protein KCTD18
4	9606.ENSP00000337732	0.623	RUN domain containing 3B
5	9606.ENSP00000362328	0.613	Potassium channel subfamily K member 17
6	9606.ENSP00000341779	0.598	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit
7	9606.ENSP00000359596	0.584	Calcium-activated chloride channel regulator 2
8	9606.ENSP00000328352	0.569	BTB/POZ domain-containing protein KCTD11
9	9606.ENSP00000301738	0.558	BTB/POZ domain-containing protein KCTD5
10	9606.ENSP00000333012	0.555	Calcium-responsive transactivator
11	9606.ENSP00000410862	0.546	RUN domain-containing protein 3A
12	9606.ENSP00000371193	0.529	Serine/threonine-protein phosphatase CPPED1
13	9606.ENSP00000297591	0.520	Protein virilizer homolog
14	9606.ENSP00000316454	0.513	Phosphofurin acidic cluster sorting protein 1
15	9606.ENSP00000324191	0.506	Potassium channel regulatory protein
16	9606.ENSP00000259154	0.502	BTB/POZ domain-containing protein KCTD3
17	9606.ENSP00000366694	0.500	BTB/POZ domain-containing protein KCTD12

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.991	regulation of cellular process
GO:0031323	0.977	regulation of cellular metabolic process
GO:0048522	0.927	positive regulation of cellular process
GO:0051174	0.860	regulation of phosphorus metabolic process
GO:0031325	0.765	positive regulation of cellular metabolic process
GO:0009987	0.758	cellular process
GO:0019220	0.699	regulation of phosphate metabolic process
GO:0010562	0.646	positive regulation of phosphorus metabolic process
GO:0042325	0.583	regulation of phosphorylation
GO:0045937	0.523	positive regulation of phosphate metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	1.000	cytoplasm
GO:0043226	0.955	organelle
GO:0043227	0.952	membrane-bounded organelle
GO:0005829	0.938	cytosol
GO:0043231	0.934	intracellular membrane-bounded organelle
GO:0016020	0.800	membrane
GO:0005634	0.794	nucleus
GO:0031974	0.789	membrane-enclosed lumen
GO:0070013	0.781	intracellular organelle lumen
GO:0031981	0.668	nuclear lumen
GO:0005654	0.604	nucleoplasm
GO:0043228	0.346	non-membrane-bounded organelle
GO:0043232	0.336	intracellular non-membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]