StarFunc result for job id Q7Z628

User Input

>input (596 residues)
MEPELAAQKQPRPRRRSRRASGLSTEGATGPSADTSGSELDGRCSLRRGSSFTFLTPGPN
WDFTLKRKRREKDDDVVSLSSLDLKEPSNKRVRPLARVTSLANLISPVRNGAVRRFGQTI
QSFTLRGDHRSPASAQKFSSRSTVPTPAKRRSSALWSEMLDITMKESLTTREIRRQEAIY
EMSRGEQDLIEDLKLARKAYHDPMLKLSIMSEEELTHIFGDLDSYIPLHEDLLTRIGEAT
KPDGTVEQIGHILVSWLPRLNAYRGYCSNQLAAKALLDQKKQDPRVQDFLQRCLESPFSR
KLDLWSFLDIPRSRLVKYPLLLKEILKHTPKEHPDVQLLEDAILIIQGVLSDINLKKGES
ECQYYIDKLEYLDEKQRDPRIEASKVLLCHGELRSKSGHKLYIFLFQDILVLTRPVTRNE
RHSYQVYRQPIPVQELVLEDLQDGDVRMGGSFRGAFSNSEKAKNIFRIRFHDPSPAQSHT
LQANDVFHKQQWFNCIRAAIAPFQSAGSPPELQGLPELHEECEGNHPSARKLTAQRRAST
VSSVTQVEVDENAYRCGSGMQMAEDSKSLKTHQTQPGIRRARDKALSGGKRKETLV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z628	0.999	0.999	1.806E-87	596	1.000	1.000	Q7Z628.pdb.gz	ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens OX=9606 GN=NET1 PE=1 SV=1
2	AFDB:Q9Z206	0.880	0.881	2.353E-76	595	0.869	0.871	Q9Z206.pdb.gz	ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus OX=10090 GN=Net1 PE=1 SV=2
3	AFDB:Q1MT42	0.598	0.697	2.236E-47	506	0.458	0.540	Q1MT42.pdb.gz	Q1MT42_DANRE Rho guanine nucleotide exchange factor 3 OS=Danio rerio OX=7955 GN=si:ch211-258l4.8 PE=4 SV=1
4	AFDB:Q8R4H2	0.428	0.184	8.012E-21	1543	0.196	0.076	Q8R4H2.pdb.gz	ARHGC_MOUSE Rho guanine nucleotide exchange factor 12 OS=Mus musculus OX=10090 GN=Arhgef12 PE=1 SV=2
5	AFDB:Q5VV41	0.426	0.368	3.101E-19	709	0.188	0.158	Q5VV41.pdb.gz	ARHGG_HUMAN Rho guanine nucleotide exchange factor 16 OS=Homo sapiens OX=9606 GN=ARHGEF16 PE=1 SV=1
6	AFDB:M0QZR4	0.463	0.300	7.736E-19	968	0.215	0.132	M0QZR4.pdb.gz	M0QZR4_HUMAN Rho guanine nucleotide exchange factor 1 OS=Homo sapiens OX=9606 GN=ARHGEF1 PE=1 SV=1
7	AFDB:G5EFE1	0.465	0.222	3.784E-18	1340	0.183	0.081	G5EFE1.pdb.gz	G5EFE1_CAEEL Guanine nucleotide exchange factor OS=Caenorhabditis elegans OX=6239 GN=rhgf-1 PE=1 SV=1
8	AFDB:D3YYY8	0.428	0.307	4.166E-18	869	0.178	0.122	D3YYY8.pdb.gz	D3YYY8_MOUSE Rho guanine nucleotide exchange factor (GEF) 26 OS=Mus musculus OX=10090 GN=Arhgef26 PE=1 SV=1
9	AFDB:A0A024R0R1	0.471	0.322	5.560E-18	912	0.190	0.124	A0A024R0R1.pdb.gz
10	PDB:4mt6A	0.335	0.490	7.827E-17	389	0.134	0.206	4mt6A.pdb.gz
11	PDB:7rx9A	0.298	0.405	1.150E-16	432	0.134	0.185	7rx9A.pdb.gz
12	AFDB:Q6ZSZ5	0.405	0.197	2.051E-16	1361	0.169	0.074	Q6ZSZ5.pdb.gz	ARHGI_HUMAN Rho guanine nucleotide exchange factor 18 OS=Homo sapiens OX=9606 GN=ARHGEF18 PE=1 SV=4
13	PDB:4gouA	0.282	0.324	7.139E-9	507	0.104	0.122	4gouA.pdb.gz
14	PDB:3pvuA	0.142	0.139	1.518E-3	609	0.067	0.066	3pvuA.pdb.gz	Molecular Mechanism of Selectivity among G Protein-Coupled Receptor Kinase 2 Inhibitors.
15	PDB:6bbpA	0.160	0.181	4.168E-3	520	0.086	0.098	6bbpA.pdb.gz	Structural Dynamics Control Allosteric Activation of Cytohesin Family Arf GTPase Exchange Factors.
16	PDB:6u3eA	0.144	0.205	4.816E-3	397	0.092	0.139	6u3eA.pdb.gz	Structural Organization and Dynamics of Homodimeric Cytohesin Family Arf GTPase Exchange Factors in Solution and on Membranes.
17	PDB:5yqrA	0.137	0.282	5.563E-3	268	0.047	0.104	5yqrA.pdb.gz
18	PDB:3ljuX	0.137	0.204	6.125E-3	373	0.035	0.056	3ljuX.pdb.gz	Phosphorylation-independent dual-site binding of the FHA domain of KIF13 mediates phosphoinositide transport via centaurin alpha1.
19	PDB:6hhgA	0.133	0.199	1.528E-2	386	0.025	0.039	6hhgA.pdb.gz	Structural and chemical insights into the covalent-allosteric inhibition of the protein kinase Akt.
20	PDB:4iapA	0.111	0.245	3.299E-2	256	0.047	0.109	4iapA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q1MT42	0.0	556	506	0.446	0.526	Q1MT42_DANRE Rho guanine nucleotide exchange factor 3 OS=Danio rerio OX=7955 GN=si:ch211-258l4.8 PE=4 SV=1
2	Q5RHT9	0.0	765	580	0.634	0.652	Q5RHT9_DANRE Neuroepithelial cell-transforming 1 OS=Danio rerio OX=7955 GN=wu:fb13g03 PE=4 SV=1
3	Q5RKM4	0.0	699	551	0.577	0.624	Q5RKM4_DANRE Neuroepithelial cell transforming gene 1 OS=Danio rerio OX=7955 GN=wu:fb25c11 PE=2 SV=1
4	Q7Z628	0.0	1226	596	1.000	1.000	ARHG8_HUMAN Neuroepithelial cell-transforming gene 1 protein OS=Homo sapiens OX=9606 GN=NET1 PE=1 SV=1
5	Q9NR81	0.0	577	526	0.451	0.511	ARHG3_HUMAN Rho guanine nucleotide exchange factor 3 OS=Homo sapiens OX=9606 GN=ARHGEF3 PE=1 SV=1
6	Q9Z206	0.0	1040	595	0.869	0.871	ARHG8_MOUSE Neuroepithelial cell-transforming gene 1 protein OS=Mus musculus OX=10090 GN=Net1 PE=1 SV=2
7	Q4WUI2	4.96e-29	125	1199	0.139	0.069	Q4WUI2_ASPFU Rho guanyl nucleotide exchange factor (Rom2), putative OS=Aspergillus fumigatus (strain ATCC MYA-4609 / CBS 101355 / FGSC A1100 / Af293) OX=330879 GN=AFUA_5G08550 PE=1 SV=1
8	Q15811	3.47e-28	123	1721	0.169	0.059	ITSN1_HUMAN Intersectin-1 OS=Homo sapiens OX=9606 GN=ITSN1 PE=1 SV=3
9	Q9Z0R4	7.99e-28	122	1714	0.169	0.059	ITSN1_MOUSE Intersectin-1 OS=Mus musculus OX=10090 GN=Itsn1 PE=1 SV=2
10	Q9WVE9	9.54e-28	121	1713	0.169	0.059	ITSN1_RAT Intersectin-1 OS=Rattus norvegicus OX=10116 GN=Itsn1 PE=1 SV=2
11	Q9Y7U6	5.29e-26	115	1334	0.146	0.065	RGF1_SCHPO Rho1 guanine nucleotide exchange factor 1 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf1 PE=1 SV=1
12	Q9UTR5	5.41e-24	109	1158	0.144	0.074	RGF2_SCHPO Rho1 guanine nucleotide exchange factor 2 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=rgf2 PE=1 SV=1
13	Q9NZM3	2.28e-22	104	1697	0.161	0.057	ITSN2_HUMAN Intersectin-2 OS=Homo sapiens OX=9606 GN=ITSN2 PE=1 SV=3
14	Q9TW28	8.80e-21	99.8	1737	0.124	0.043	MYOM_DICDI Myosin-M heavy chain OS=Dictyostelium discoideum OX=44689 GN=myoM PE=1 SV=1
15	Q9Z0R6	2.19e-20	98.6	1659	0.161	0.058	ITSN2_MOUSE Intersectin-2 OS=Mus musculus OX=10090 GN=Itsn2 PE=1 SV=2
16	Q3LAC4	4.16e-20	97.4	1598	0.149	0.056	PREX2_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Mus musculus OX=10090 GN=Prex2 PE=1 SV=2
17	Q70Z35	5.60e-20	97.1	1606	0.144	0.054	PREX2_HUMAN Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 2 protein OS=Homo sapiens OX=9606 GN=PREX2 PE=1 SV=1
18	Q49U75	6.40e-20	97.1	1417	0.119	0.050	Q49U75_DANRE PDZ-RhoGEF OS=Danio rerio OX=7955 GN=arhgef11 PE=1 SV=1
19	F1R6J2	2.17e-19	95.5	1622	0.139	0.051	F1R6J2_DANRE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Danio rerio OX=7955 GN=prex1 PE=1 SV=1
20	Q69ZK0	2.23e-18	92.0	1650	0.133	0.048	PREX1_MOUSE Phosphatidylinositol 3,4,5-trisphosphate-dependent Rac exchanger 1 protein OS=Mus musculus OX=10090 GN=Prex1 PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF16453 IQ_SEC7_PH	1.8e+02	13.4	PH domain
2	PF00169 PH	0.0001	34.1	PH domain
3	PF16652 PH_13	0.0039	28.6	Pleckstrin homology domain
4	PF15405 PH_5	0.00038	32.0	Pleckstrin homology domain
5	PF00621 RhoGEF	5.6e-33	126.2	RhoGEF domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000347134

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000400175	0.997	Transforming protein RhoA
2	9606.ENSP00000272233	0.785	Rho-related GTP-binding protein RhoB
3	9606.ENSP00000285735	0.751	Rho-related GTP-binding protein RhoC
4	9606.ENSP00000385450	0.703	Membrane-associated guanylate kinase, WW and PDZ domain-containing protein 1
5	9606.ENSP00000345731	0.688	Disks large homolog 1
6	9606.ENSP00000218004	0.594	NTF2-related export protein 2
7	9606.ENSP00000369538	0.541	Rab GDP dissociation inhibitor beta
8	9606.ENSP00000267257	0.516	Paxillin
9	9606.ENSP00000378332	0.516	Transforming growth factor beta-1-induced transcript 1 protein

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005085	1.000	guanyl-nucleotide exchange factor activity
GO:0008047	0.461	enzyme activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.989	regulation of cellular process
GO:0050896	0.986	response to stimulus
GO:0023052	0.984	signaling
GO:0009966	0.957	regulation of signal transduction
GO:0007154	0.950	cell communication
GO:0051716	0.945	cellular response to stimulus
GO:0007165	0.864	signal transduction
GO:1902531	0.706	regulation of intracellular signal transduction
GO:0051056	0.583	regulation of small GTPase mediated signal transduction
GO:0048518	0.548	positive regulation of biological process
GO:0048522	0.531	positive regulation of cellular process
GO:0065009	0.310	regulation of molecular function

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043229	0.972	intracellular organelle
GO:0043227	0.962	membrane-bounded organelle
GO:0043231	0.952	intracellular membrane-bounded organelle
GO:0005634	0.899	nucleus
GO:0016020	0.322	membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]