StarFunc result for job id Q7Z695

User Input

>input (626 residues)
MVAPWRVSVRVCLSHLRCFELRQGLSLLRPSECPRDARLCWLLLGTLPKVVSLCGDVGEG
APDVLSRRRVRCSGAAGAGPAESLPRAGPLGGVFLHLRLWLRAGALLVKFFPLLLLYPLT
YLAPSVSTLWLHLLLKATETSGPTYIKLGQWASTRRDLFSEAFCAQFSKLHVRVTPHPWT
HTERFLRQAFGDDWGSILSFENREPVGSGCVAQVYKAYANTAFLETDSVQRLGRASCLPP
FSHTGAVGGLRELFGYLGNGRKPPENLADQSFLERLLLPKADLVGSNAGVSRAQVPGHQP
EATNLISVAVKVLHPGLLAQVHMDLLLMKIGSRVLGVLPGIKWLSLPEIVEEFEKLMVQQ
IDLRYEAQNLEHFQVNFRNVKAVKFPTPLRPFVTREVLVETYEESVPVSSYQQAGIPVDL
KRKIARLGINMLLKMIFVDNFVHADLHPGNILVQGANGLSSSQEAQLQQADICDTLVVAV
PSSLCPLRLVLLDAGIVAELQAPDLRNFRAVFMAVVMGQGQRVAELILHHARASECRDVE
GFKTEMAMLVTQARKNTITLEKLHVSSLLSSVFKLLMTHKVKLESNFASIVFAIMVLEGL
GRSLDPKLDILEAARPFLLTGPVCPP

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z695	1.000	1.000	5.150E-93	626	1.000	1.000	Q7Z695.pdb.gz	ADCK2_HUMAN Uncharacterized aarF domain-containing protein kinase 2 OS=Homo sapiens OX=9606 GN=ADCK2 PE=1 SV=1
2	AFDB:Q6NSR3	0.733	0.743	4.401E-68	617	0.735	0.746	Q6NSR3.pdb.gz	ADCK2_MOUSE Uncharacterized aarF domain-containing protein kinase 2 OS=Mus musculus OX=10090 GN=Adck2 PE=2 SV=1
3	AFDB:Q9P7M0	0.633	0.574	7.243E-33	692	0.294	0.266	Q9P7M0.pdb.gz	YOS3_SCHPO ABC1 family protein C21C3.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21C3.03 PE=3 SV=2
4	AFDB:F4I8V6	0.635	0.637	1.501E-29	624	0.260	0.261	F4I8V6.pdb.gz	F4I8V6_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g11390 PE=1 SV=1
5	AFDB:Q02981	0.632	0.604	1.012E-28	657	0.256	0.244	Q02981.pdb.gz	YP109_YEAST ABC1 family protein YPL109C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPL109C PE=1 SV=2
6	AFDB:Q38AA0	0.593	0.696	8.718E-24	529	0.204	0.242	Q38AA0.pdb.gz	Q38AA0_TRYB2 Protein kinase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1800 PE=4 SV=1
7	AFDB:Q8RWG1	0.605	0.557	4.765E-19	682	0.163	0.150	Q8RWG1.pdb.gz	AB1K1_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K1 PE=1 SV=1
8	AFDB:P0A6A0	0.533	0.604	1.950E-18	546	0.179	0.205	P0A6A0.pdb.gz	UBIB_ECOLI Probable protein kinase UbiB OS=Escherichia coli (strain K12) OX=83333 GN=ubiB PE=1 SV=1
9	AFDB:Q93Y08	0.546	0.455	3.576E-17	761	0.201	0.166	Q93Y08.pdb.gz	AB1K8_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K8 PE=2 SV=1
10	AFDB:F4JFM1	0.563	0.491	6.456E-17	724	0.187	0.162	F4JFM1.pdb.gz	F4JFM1_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SIA1 PE=1 SV=1
11	PDB:5yk1A	0.390	0.582	6.809E-8	401	0.123	0.192	5yk1A.pdb.gz	Discovery of the first macrolide antibiotic binding protein in Mycobacterium tuberculosis: a new antibiotic resistance drug target.
12	PDB:6zxfz	0.184	0.291	6.136E-3	373	0.062	0.105	6zxfz.pdb.gz	Structural basis for the final steps of human 40S ribosome maturation.
13	PDB:6g18v	0.168	0.293	1.059E-2	325	0.075	0.145	6g18v.pdb.gz	Visualizing late states of human 40S ribosomal subunit maturation.
14	PDB:5oniA	0.167	0.283	1.523E-2	334	0.083	0.156	5oniA.pdb.gz	Unexpected Binding Mode of a Potent Indeno[1,2-b]indole-Type Inhibitor of Protein Kinase CK2 Revealed by Complex Structures with the Catalytic Subunit CK2 alpha and Its Paralog CK2 alpha '.
15	PDB:6dflA	0.147	0.344	2.093E-2	241	0.046	0.120	6dflA.pdb.gz	Acylated-acyl carrier protein stabilizes the Pseudomonas aeruginosa WaaP lipopolysaccharide heptose kinase.
16	PDB:4da5A	0.170	0.269	2.399E-2	352	0.080	0.142	4da5A.pdb.gz	Kinetic and mechanistic characterisation of Choline Kinase-alpha.
17	PDB:6qx9K	0.172	0.309	2.750E-2	322	0.070	0.137	6qx9K.pdb.gz	Mechanism of 5' splice site transfer for human spliceosome activation.
18	PDB:2ig7B	0.165	0.265	2.877E-2	342	0.085	0.155	2ig7B.pdb.gz
19	PDB:6fadC	0.161	0.257	3.298E-2	359	0.058	0.100	6fadC.pdb.gz	Molecular Mechanism of SR Protein Kinase 1 Inhibition by the Herpes Virus Protein ICP27.
20	PDB:2yaaA	0.163	0.292	3.780E-2	300	0.058	0.120	2yaaA.pdb.gz	Structure of the Dimeric Autoinhibited Conformation of Dapk2, a Pro-Apoptotic Protein Kinase.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q6NSR3	0.0	920	617	0.743	0.754	ADCK2_MOUSE Uncharacterized aarF domain-containing protein kinase 2 OS=Mus musculus OX=10090 GN=Adck2 PE=2 SV=1
2	Q7Z695	0.0	1270	626	1.000	1.000	ADCK2_HUMAN Uncharacterized aarF domain-containing protein kinase 2 OS=Homo sapiens OX=9606 GN=ADCK2 PE=1 SV=1
3	Q9P7M0	3.78e-77	261	692	0.270	0.244	YOS3_SCHPO ABC1 family protein C21C3.03, mitochondrial OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBC21C3.03 PE=3 SV=2
4	Q02981	5.61e-57	205	657	0.185	0.177	YP109_YEAST ABC1 family protein YPL109C, mitochondrial OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YPL109C PE=1 SV=2
5	F4I8V6	2.68e-47	178	624	0.185	0.186	F4I8V6_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At1g11390 PE=1 SV=1
6	Q38AA0	4.77e-29	123	529	0.129	0.153	Q38AA0_TRYB2 Protein kinase domain-containing protein OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb10.6k15.1800 PE=4 SV=1
7	P0A6A0	1.30e-19	95.1	546	0.123	0.141	UBIB_ECOLI Probable protein kinase UbiB OS=Escherichia coli (strain K12) OX=83333 GN=ubiB PE=1 SV=1
8	Q93Y08	1.45e-15	82.8	761	0.152	0.125	AB1K8_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 8, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K8 PE=2 SV=1
9	B9DGY1	7.85e-13	73.9	695	0.117	0.105	AB1K7_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 7, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K7 PE=1 SV=1
10	F4JFM1	6.14e-11	67.8	724	0.120	0.104	F4JFM1_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=SIA1 PE=1 SV=1
11	Q9D0L4	2.31e-10	65.9	525	0.083	0.099	ADCK1_MOUSE AarF domain-containing protein kinase 1 OS=Mus musculus OX=10090 GN=Adck1 PE=1 SV=1
12	Q86TW2	5.92e-10	64.3	530	0.096	0.113	ADCK1_HUMAN AarF domain-containing protein kinase 1 OS=Homo sapiens OX=9606 GN=ADCK1 PE=1 SV=2
13	Q9MA15	4.73e-09	62.0	711	0.113	0.100	AB1K3_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 3, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K3 PE=1 SV=1
14	Q8RWG1	5.50e-09	61.6	682	0.118	0.109	AB1K1_ARATH Protein ACTIVITY OF BC1 COMPLEX KINASE 1, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=ABC1K1 PE=1 SV=1
15	Q0WSU9	1.41e-08	60.1	479	0.093	0.121	Q0WSU9_ARATH At5g50330 OS=Arabidopsis thaliana OX=3702 GN=MXI22.4 PE=1 SV=1
16	Q9W133	2.53e-08	59.3	518	0.078	0.095	ADCK_DROME AarF domain-containing kinase 1 OS=Drosophila melanogaster OX=7227 GN=Adck1 PE=1 SV=2
17	Q9LRN0	3.84e-06	52.4	793	0.109	0.086	Q9LRN0_ARATH AT3g24190/MUJ8_17 OS=Arabidopsis thaliana OX=3702 GN=At3g24190 PE=1 SV=1
18	Q94BU1	4.12e-06	52.4	692	0.107	0.097	Y1181_ARATH Uncharacterized aarF domain-containing protein kinase At1g71810, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At1g71810 PE=1 SV=1
19	F4JRQ4	4.85e-06	52.0	481	0.085	0.110	F4JRQ4_ARATH Protein kinase superfamily protein OS=Arabidopsis thaliana OX=3702 GN=At4g24810 PE=1 SV=1
20	Q9ASX5	1.70e-05	50.1	540	0.121	0.141	Y5520_ARATH Uncharacterized aarF domain-containing protein kinase At5g05200, chloroplastic OS=Arabidopsis thaliana OX=3702 GN=At5g05200 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03109 ABC1	1.6e-42	156.9	ABC1 atypical kinase-like domain
2	PF10156 Med17	3.8e+02	11.2	Subunit 17 of Mediator complex
3	PF00069 Pkinase	5.7e+02	11.2	Protein kinase domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000072869

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000254759	0.770	Ubiquinone biosynthesis O-methyltransferase, mitochondrial
2	9606.ENSP00000288532	0.740	2-methoxy-6-polyprenyl-1,4-benzoquinol methylase, mitochondrial
3	9606.ENSP00000355741	0.658	Atypical kinase COQ8A, mitochondrial
4	9606.ENSP00000430985	0.631	Ankyrin repeat domain-containing protein 6
5	9606.ENSP00000310873	0.626	4-hydroxybenzoate polyprenyltransferase, mitochondrial
6	9606.ENSP00000366528	0.622	Transmembrane protein 252
7	9606.ENSP00000315118	0.615	Atypical kinase COQ8B, mitochondrial
8	9606.ENSP00000347005	0.611	Putative RNA-binding protein Luc7-like 2
9	9606.ENSP00000322316	0.606	5-demethoxyubiquinone hydroxylase, mitochondrial
10	9606.ENSP00000440222	0.605	Putative RNA-binding protein Luc7-like 2
11	9606.ENSP00000333946	0.601	Ubiquinone biosynthesis monooxygenase COQ6, mitochondrial
12	9606.ENSP00000262507	0.583	Ubiquinone biosynthesis protein COQ9, mitochondrial
13	9606.ENSP00000253233	0.566	Probable peptide chain release factor C12orf65, mitochondrial
14	9606.ENSP00000376732	0.562	Mitochondrial ribosomal protein S33
15	9606.ENSP00000300452	0.530	Ubiquinone biosynthesis protein COQ4 homolog, mitochondrial
16	9606.ENSP00000386456	0.529	AP2-associated protein kinase 1
17	9606.ENSP00000238561	0.508	Uncharacterized aarF domain-containing protein kinase 1
18	9606.ENSP00000310547	0.507	Uncharacterized aarF domain-containing protein kinase 5
19	9606.ENSP00000239690	0.502	NudC domain containing 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0003824	0.796	catalytic activity
GO:0016740	0.344	transferase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0009987	0.967	cellular process
GO:0071704	0.872	organic substance metabolic process
GO:0050789	0.826	regulation of biological process
GO:0050794	0.687	regulation of cellular process
GO:0044237	0.632	cellular metabolic process
GO:0050896	0.397	response to stimulus
GO:0044238	0.391	primary metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005739	1.000	mitochondrion
GO:0005829	0.418	cytosol
GO:0070013	0.370	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.344	Transferases.

[back to server]