StarFunc result for job id Q7Z698

User Input

>input (418 residues)
MTEETHPDDDSYIVRVKAVVMTRDDSSGGWFPQEGGGISRVGVCKVMHPEGNGRSGFLIH
GERQKDKLVVLECYVRKDLVYTKANPTFHHWKVDNRKFGLTFQSPADARAFDRGVRKAIE
DLIEGSTTSSSTIHNEAELGDDDVFTTATDSSSNSSQKREQPTRTISSPTSCEHRRIYTL
GHLHDSYPTDHYHLDQPMPRPYRQVSFPDDDEEIVRINPREKIWMTGYEDYRHAPVRGKY
PDPSEDADSSYVRFAKGEVPKHDYNYPYVDSSDFGLGEDPKGRGGSVIKTQPSRGKSRRR
KEDGERSRCVYCRDMFNHEENRRGHCQDAPDSVRTCIRRVSCMWCADSMLYHCMSDPEGD
YTDPCSCDTSDEKFCLRWMALIALSFLAPCMCCYLPLRACYHCGVMCRCCGGKHKAAA

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z698	1.000	1.000	4.322E-74	418	1.000	1.000	Q7Z698.pdb.gz	SPRE2_HUMAN Sprouty-related, EVH1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SPRED2 PE=1 SV=2
2	AFDB:F1R8L9	0.602	0.640	2.943E-44	391	0.514	0.550	F1R8L9.pdb.gz
3	AFDB:Q3C2P9	0.551	0.521	1.228E-41	444	0.533	0.502	Q3C2P9.pdb.gz
4	AFDB:Q6P6N5	0.428	0.436	9.844E-35	408	0.376	0.385	Q6P6N5.pdb.gz	SPRE3_MOUSE Sprouty-related, EVH1 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Spred3 PE=1 SV=1
5	AFDB:O08719	0.260	0.259	4.664E-9	420	0.153	0.152	O08719.pdb.gz	EVL_RAT Ena/VASP-like protein OS=Rattus norvegicus OX=10116 GN=Evl PE=1 SV=2
6	AFDB:A0A024QYX8	0.238	0.201	2.555E-7	502	0.105	0.088	A0A024QYX8.pdb.gz
7	AFDB:P91621	0.217	0.048	5.432E-7	2072	0.146	0.029	P91621.pdb.gz	SIF1_DROME Protein still life, isoform SIF type 1 OS=Drosophila melanogaster OX=7227 GN=sif PE=2 SV=2
8	PDB:3m1iB	0.239	0.691	5.707E-6	131	0.041	0.130	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
9	PDB:1k5dB	0.237	0.634	1.363E-5	146	0.038	0.110	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
10	AFDB:O43609	0.193	0.248	7.528E-5	319	0.146	0.191	O43609.pdb.gz	SPY1_HUMAN Protein sprouty homolog 1 OS=Homo sapiens OX=9606 GN=SPRY1 PE=1 SV=2
11	AFDB:Q8BSM5	0.217	0.159	2.139E-4	595	0.098	0.069	Q8BSM5.pdb.gz	GAB3_MOUSE GRB2-associated-binding protein 3 OS=Mus musculus OX=10090 GN=Gab3 PE=1 SV=1
12	PDB:2qkmG	0.180	0.497	2.784E-4	127	0.036	0.118	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.
13	PDB:2kr0A	0.220	0.224	5.918E-4	407	0.055	0.057	2kr0A.pdb.gz
14	AFDB:F1QZW4	0.196	0.256	8.123E-4	310	0.132	0.177	F1QZW4.pdb.gz
15	PDB:1q67B	0.212	0.494	1.258E-3	161	0.031	0.081	1q67B.pdb.gz
16	PDB:6am0F	0.192	0.400	2.675E-3	178	0.050	0.118	6am0F.pdb.gz	Structure of the activated Edc1-Dcp1-Dcp2-Edc3 mRNA decapping complex with substrate analog poised for catalysis.
17	PDB:7mp5A	0.168	0.050	2.425E-2	1629	0.017	0.004	7mp5A.pdb.gz
18	PDB:6r9tA	0.147	0.034	3.858E-2	2185	0.036	0.007	6r9tA.pdb.gz
19	PDB:7ploO	0.197	0.214	5.156E-2	382	0.038	0.042	7ploO.pdb.gz	A conserved mechanism for regulating replisome disassembly in eukaryotes.
20	PDB:5yfpH	0.200	0.165	6.891E-2	518	0.029	0.023	5yfpH.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z698	0.0	871	418	1.000	1.000	SPRE2_HUMAN Sprouty-related, EVH1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SPRED2 PE=1 SV=2
2	Q924S7	0.0	788	410	0.921	0.939	SPRE2_MOUSE Sprouty-related, EVH1 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Spred2 PE=1 SV=1
3	Q7Z699	2.50e-135	397	444	0.577	0.543	SPRE1_HUMAN Sprouty-related, EVH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=2
4	Q924S8	3.43e-135	397	444	0.569	0.536	SPRE1_MOUSE Sprouty-related, EVH1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Spred1 PE=1 SV=1
5	Q6NV01	6.51e-135	394	391	0.526	0.563	Q6NV01_DANRE Sprouty-related, EVH1 domain containing 1 OS=Danio rerio OX=7955 GN=zgc:85707 PE=2 SV=1
6	Q7K0G4	1.43e-62	209	426	0.349	0.343	Q7K0G4_DROME SD10629p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
7	Q6P6N5	3.67e-61	205	408	0.385	0.395	SPRE3_MOUSE Sprouty-related, EVH1 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Spred3 PE=1 SV=1
8	F0JAK5	1.38e-59	201	404	0.342	0.354	F0JAK5_DROME LD31195p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
9	H0YMN8	2.92e-49	165	131	0.199	0.634	H0YMN8_HUMAN Sprouty related EVH1 domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=1
10	A0A0B4KG11	3.33e-31	127	519	0.160	0.129	A0A0B4KG11_DROME Sprouty-related protein with EVH-1 domain, isoform C OS=Drosophila melanogaster OX=7227 GN=Spred PE=4 SV=1
11	A0A8I5ZT50	1.48e-11	68.6	803	0.096	0.050	A0A8I5ZT50_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
12	A0A8I6GMP8	1.54e-11	68.6	788	0.096	0.051	A0A8I6GMP8_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
13	A0A8I5Y4S4	1.72e-11	68.6	805	0.096	0.050	A0A8I5Y4S4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
14	A0A8I6G5W6	1.95e-11	68.2	788	0.096	0.051	A0A8I6G5W6_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
15	Q03173	1.96e-11	68.2	802	0.096	0.050	ENAH_MOUSE Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2
16	A0A8I5ZND4	1.98e-11	68.2	570	0.096	0.070	A0A8I5ZND4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
17	A0A0U1RRM6	2.30e-11	68.2	802	0.096	0.050	A0A0U1RRM6_HUMAN ENAH actin regulator OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=1
18	A0A0G2K6I4	2.35e-11	67.8	563	0.096	0.071	A0A0G2K6I4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=2
19	Q8T4F7	2.40e-11	68.2	980	0.089	0.038	ENA_DROME Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4
20	Q5XHX3	2.54e-11	67.8	526	0.096	0.076	Q5XHX3_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF05210 Sprouty	5.9e-27	105.7	Sprouty protein (Spry)
2	PF00568 WH1	9.1e-07	40.2	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 61853.ENSNLEP00000012132

Rank	PPI partner	STRING score	Description
1	61853.ENSNLEP00000013316	0.822	Neurofibromin 1
2	61853.ENSNLEP00000021123	0.685	Proteasome (prosome, macropain) subunit, beta type, 6
3	61853.ENSNLEP00000010109	0.661	HRas proto-oncogene, GTPase
4	61853.ENSNLEP00000008235	0.651	Proteasome (prosome, macropain) subunit, beta type, 9
5	61853.ENSNLEP00000001162	0.637	Fibroblast growth factor receptor-like 1
6	61853.ENSNLEP00000020623	0.637	Mohawk homeobox
7	61853.ENSNLEP00000012454	0.634	Adducin 2 (beta)
8	61853.ENSNLEP00000016465	0.633	RAS p21 protein activator (GTPase activating protein) 1
9	61853.ENSNLEP00000014414	0.630	Proteasome (prosome, macropain) activator subunit 3 (PA28 gamma
10	61853.ENSNLEP00000017031	0.630	Proteasome (prosome, macropain) 26S subunit, non-ATPase, 1
11	61853.ENSNLEP00000003464	0.628	Proteasome (prosome, macropain) subunit, alpha type, 5
12	61853.ENSNLEP00000015936	0.624	Proteasome (prosome, macropain) subunit, alpha type, 3
13	61853.ENSNLEP00000011891	0.616	Cullin 3
14	61853.ENSNLEP00000014657	0.606	NBR1, autophagy cargo receptor
15	61853.ENSNLEP00000000536	0.561	Moesin
16	61853.ENSNLEP00000000983	0.528	Profilin family, member 4
17	61853.ENSNLEP00000003867	0.528	Profilin 2
18	61853.ENSNLEP00000006371	0.528	KRAS proto-oncogene, GTPase
19	61853.ENSNLEP00000007175	0.528	Uncharacterized protein
20	61853.ENSNLEP00000021166	0.528	Profilin

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050789	0.995	regulation of biological process
GO:0050794	0.994	regulation of cellular process
GO:0051171	0.947	regulation of nitrogen compound metabolic process
GO:0080090	0.946	regulation of primary metabolic process
GO:0060255	0.946	regulation of macromolecule metabolic process
GO:0048519	0.944	negative regulation of biological process
GO:0009966	0.941	regulation of signal transduction
GO:0051246	0.923	regulation of protein metabolic process
GO:0048523	0.920	negative regulation of cellular process
GO:0051248	0.904	negative regulation of protein metabolic process
GO:0010799	0.904	regulation of peptidyl-threonine phosphorylation
GO:0001933	0.888	negative regulation of protein phosphorylation
GO:0048518	0.794	positive regulation of biological process
GO:0010717	0.760	regulation of epithelial to mesenchymal transition
GO:0048522	0.684	positive regulation of cellular process
GO:0090287	0.665	regulation of cellular response to growth factor stimulus
GO:0009987	0.499	cellular process
GO:1902531	0.483	regulation of intracellular signal transduction
GO:0009968	0.388	negative regulation of signal transduction
GO:0017015	0.338	regulation of transforming growth factor beta receptor signaling pathway
GO:0030856	0.337	regulation of epithelial cell differentiation
GO:0090101	0.322	negative regulation of transmembrane receptor protein serine/threonine kinase signaling pathway
GO:0030857	0.312	negative regulation of epithelial cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005829	0.996	cytosol
GO:0016020	0.994	membrane
GO:0005886	0.984	plasma membrane
GO:0031982	0.960	vesicle
GO:0031410	0.953	cytoplasmic vesicle
GO:0070013	0.930	intracellular organelle lumen
GO:0031981	0.906	nuclear lumen
GO:0005654	0.904	nucleoplasm
GO:0032991	0.522	protein-containing complex

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]