StarFunc result for job id Q7Z699

User Input

>input (444 residues)
MSEETATSDNDNSYARVRAVVMTRDDSSGGWLPLGGSGLSSVTVFKVPHQEENGCADFFI
RGERLRDKMVVLECMLKKDLIYNKVTPTFHHWKIDDKKFGLTFQSPADARAFDRGIRRAI
EDISQGCPESKNEAEGADDLQANEEDSSSSLVKDHLFQQETVVTSEPYRSSNIRPSPFED
LNARRVYMQSQANQITFGQPGLDIQSRSMEYVQRQISKECGSLKSQNRVPLKSIRHVSFQ
DEDEIVRINPRDILIRRYADYRHPDMWKNDLERDDADSSIQFSKPDSKKSDYLYSCGDET
KLSSPKDSVVFKTQPSSLKIKKSKRRKEDGERSRCVYCQERFNHEENVRGKCQDAPDPIK
RCIYQVSCMLCAESMLYHCMSDSEGDFSDPCSCDTSDDKFCLRWLALVALSFIVPCMCCY
VPLRMCHRCGEACGCCGGKHKAAG

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q3C2P9	0.753	0.753	1.361E-69	444	0.919	0.919	Q3C2P9.pdb.gz
2	AFDB:F1R8L9	0.605	0.683	6.015E-45	391	0.550	0.624	F1R8L9.pdb.gz
3	AFDB:Q7Z698	0.549	0.582	1.878E-40	418	0.532	0.565	Q7Z698.pdb.gz	SPRE2_HUMAN Sprouty-related, EVH1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SPRED2 PE=1 SV=2
4	AFDB:O00401	0.210	0.186	5.139E-5	505	0.090	0.079	O00401.pdb.gz	WASL_HUMAN Actin nucleation-promoting factor WASL OS=Homo sapiens OX=9606 GN=WASL PE=1 SV=2
5	PDB:1k5dB	0.234	0.654	5.529E-5	146	0.045	0.137	1k5dB.pdb.gz	RanGAP mediates GTP hydrolysis without an arginine finger.
6	PDB:3m1iB	0.222	0.681	5.529E-5	131	0.041	0.137	3m1iB.pdb.gz	An allosteric mechanism to displace nuclear export cargo from CRM1 and RanGTP by RanBP1
7	AFDB:Q9ES28	0.180	0.101	3.760E-4	862	0.101	0.052	Q9ES28.pdb.gz	ARHG7_MOUSE Rho guanine nucleotide exchange factor 7 OS=Mus musculus OX=10090 GN=Arhgef7 PE=1 SV=2
8	PDB:2kr0A	0.201	0.216	8.004E-4	407	0.077	0.084	2kr0A.pdb.gz
9	AFDB:B0S6R3	0.191	0.165	1.848E-3	530	0.099	0.083	B0S6R3.pdb.gz
10	AFDB:A0A384NQ31	0.145	0.129	2.751E-3	512	0.092	0.080	A0A384NQ31.pdb.gz	A0A384NQ31_HUMAN Epididymis secretory sperm binding protein OS=Homo sapiens OX=9606 PE=1 SV=1
11	AFDB:Q494U1	0.187	0.143	2.751E-3	611	0.099	0.072	Q494U1.pdb.gz	PKHN1_HUMAN Pleckstrin homology domain-containing family N member 1 OS=Homo sapiens OX=9606 GN=PLEKHN1 PE=1 SV=3
12	PDB:2qkmG	0.181	0.557	3.933E-3	127	0.036	0.126	2qkmG.pdb.gz	Structural basis of dcp2 recognition and activation by dcp1.
13	PDB:1q67B	0.191	0.437	4.407E-3	161	0.036	0.099	1q67B.pdb.gz
14	AFDB:B6RSP1	0.169	0.068	6.099E-3	1197	0.131	0.048	B6RSP1.pdb.gz	PKHA7_DANRE Pleckstrin homology domain-containing family A member 7 OS=Danio rerio OX=7955 GN=plekha7 PE=2 SV=2
15	PDB:6oxlN	0.188	0.562	6.199E-3	124	0.036	0.129	6oxlN.pdb.gz	A structural mechanism for phosphorylation-dependent inactivation of the AP2 complex.
16	AFDB:Q9Y2H5	0.166	0.080	1.017E-2	1048	0.099	0.042	Q9Y2H5.pdb.gz	PKHA6_HUMAN Pleckstrin homology domain-containing family A member 6 OS=Homo sapiens OX=9606 GN=PLEKHA6 PE=1 SV=4
17	PDB:7pgrN	0.147	0.034	1.826E-2	2423	0.027	0.005	7pgrN.pdb.gz	The structure of neurofibromin isoform 2 reveals different functional states.
18	PDB:7r03B	0.126	0.031	6.027E-2	2246	0.020	0.004	7r03B.pdb.gz
19	PDB:7mp5A	0.154	0.047	6.380E-2	1629	0.018	0.005	7mp5A.pdb.gz
20	PDB:4mt6A	0.168	0.188	8.974E-2	389	0.027	0.031	4mt6A.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z699	0.0	923	444	1.000	1.000	SPRE1_HUMAN Sprouty-related, EVH1 domain-containing protein 1 OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=2
2	Q924S8	0.0	826	444	0.932	0.932	SPRE1_MOUSE Sprouty-related, EVH1 domain-containing protein 1 OS=Mus musculus OX=10090 GN=Spred1 PE=1 SV=1
3	Q6NV01	3.39e-158	454	391	0.559	0.634	Q6NV01_DANRE Sprouty-related, EVH1 domain containing 1 OS=Danio rerio OX=7955 GN=zgc:85707 PE=2 SV=1
4	Q924S7	9.62e-145	421	410	0.527	0.571	SPRE2_MOUSE Sprouty-related, EVH1 domain-containing protein 2 OS=Mus musculus OX=10090 GN=Spred2 PE=1 SV=1
5	Q7Z698	1.58e-143	418	418	0.543	0.577	SPRE2_HUMAN Sprouty-related, EVH1 domain-containing protein 2 OS=Homo sapiens OX=9606 GN=SPRED2 PE=1 SV=2
6	H0YMN8	6.64e-92	275	131	0.295	1.000	H0YMN8_HUMAN Sprouty related EVH1 domain containing 1 (Fragment) OS=Homo sapiens OX=9606 GN=SPRED1 PE=1 SV=1
7	Q7K0G4	5.37e-29	120	426	0.133	0.138	Q7K0G4_DROME SD10629p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
8	A0A0B4KG11	1.17e-28	120	519	0.133	0.114	A0A0B4KG11_DROME Sprouty-related protein with EVH-1 domain, isoform C OS=Drosophila melanogaster OX=7227 GN=Spred PE=4 SV=1
9	F0JAK5	3.46e-28	117	404	0.119	0.131	F0JAK5_DROME LD31195p OS=Drosophila melanogaster OX=7227 GN=Spred PE=2 SV=1
10	Q6P6N5	1.04e-25	110	408	0.140	0.152	SPRE3_MOUSE Sprouty-related, EVH1 domain-containing protein 3 OS=Mus musculus OX=10090 GN=Spred3 PE=1 SV=1
11	Q8T4F7	9.12e-16	82.4	980	0.099	0.045	ENA_DROME Protein enabled OS=Drosophila melanogaster OX=7227 GN=ena PE=1 SV=4
12	A0A8I5ZT50	4.22e-15	80.1	803	0.101	0.056	A0A8I5ZT50_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
13	Q03173	6.23e-15	79.7	802	0.101	0.056	ENAH_MOUSE Protein enabled homolog OS=Mus musculus OX=10090 GN=Enah PE=1 SV=2
14	A0A0G2K6I4	6.34e-15	79.3	563	0.090	0.071	A0A0G2K6I4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=2
15	A0A8I5Y4S4	6.47e-15	79.3	805	0.090	0.050	A0A8I5Y4S4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
16	A0A8I6G5W6	6.63e-15	79.3	788	0.090	0.051	A0A8I6G5W6_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
17	A0A8I6GMP8	6.69e-15	79.3	788	0.090	0.051	A0A8I6GMP8_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=3 SV=1
18	A0A8I5ZND4	6.89e-15	79.0	570	0.090	0.070	A0A8I5ZND4_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
19	Q5XHX3	7.11e-15	79.0	526	0.090	0.076	Q5XHX3_RAT ENAH, actin regulator OS=Rattus norvegicus OX=10116 GN=Enah PE=1 SV=1
20	Q8N8S7	7.66e-15	79.0	591	0.090	0.068	ENAH_HUMAN Protein enabled homolog OS=Homo sapiens OX=9606 GN=ENAH PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF02616 SMC_ScpA	6.1e+02	11.7	Segregation and condensation protein ScpA
2	PF05210 Sprouty	2.2e-27	107.1	Sprouty protein (Spry)
3	PF00568 WH1	1.2e-08	46.2	WH1 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000299084

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000351015	0.997	Neurofibromin
2	9606.ENSP00000407586	0.960	GTPase HRas
3	9606.ENSP00000256078	0.944	GTPase KRas
4	9606.ENSP00000270586	0.939	Proteasome subunit beta type-6
5	9606.ENSP00000363993	0.909	Proteasome subunit beta type-9
6	9606.ENSP00000264414	0.905	Cullin-3
7	9606.ENSP00000368797	0.904	Kelch repeat and BTB domain containing 7
8	9606.ENSP00000216455	0.902	Proteasome subunit alpha type-3
9	9606.ENSP00000271308	0.902	Proteasome subunit alpha type-5
10	9606.ENSP00000309474	0.902	26S proteasome non-ATPase regulatory subunit 1
11	9606.ENSP00000262193	0.901	Proteasome subunit beta type-1
12	9606.ENSP00000272317	0.901	Ubiquitin-40S ribosomal protein S27a
13	9606.ENSP00000401802	0.901	26S proteasome regulatory subunit 10B
14	9606.ENSP00000044462	0.900	Proteasome subunit alpha type-4
15	9606.ENSP00000157812	0.900	26S proteasome regulatory subunit 6B
16	9606.ENSP00000210313	0.900	26S proteasome non-ATPase regulatory subunit 5
17	9606.ENSP00000215071	0.900	26S proteasome non-ATPase regulatory subunit 8
18	9606.ENSP00000216225	0.900	E3 ubiquitin-protein ligase RBX1
19	9606.ENSP00000216802	0.900	Proteasome activator complex subunit 2
20	9606.ENSP00000217958	0.900	26S proteasome non-ATPase regulatory subunit 10

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0019902	0.661	phosphatase binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0048519	0.995	negative regulation of biological process
GO:0001932	0.995	regulation of protein phosphorylation
GO:0001933	0.994	negative regulation of protein phosphorylation
GO:0043408	0.981	regulation of MAPK cascade
GO:1901342	0.978	regulation of vasculature development
GO:0009968	0.975	negative regulation of signal transduction
GO:1902532	0.967	negative regulation of intracellular signal transduction
GO:0043409	0.961	negative regulation of MAPK cascade
GO:0051093	0.956	negative regulation of developmental process
GO:0051241	0.954	negative regulation of multicellular organismal process
GO:0045765	0.945	regulation of angiogenesis
GO:0009987	0.911	cellular process
GO:1901343	0.909	negative regulation of vasculature development
GO:2000145	0.881	regulation of cell motility
GO:2000181	0.881	negative regulation of blood vessel morphogenesis
GO:0051338	0.863	regulation of transferase activity
GO:0048518	0.854	positive regulation of biological process
GO:0040013	0.851	negative regulation of locomotion
GO:0016525	0.840	negative regulation of angiogenesis
GO:0010632	0.809	regulation of epithelial cell migration
GO:2000146	0.788	negative regulation of cell motility
GO:0080135	0.730	regulation of cellular response to stress
GO:0010594	0.716	regulation of endothelial cell migration
GO:0048522	0.702	positive regulation of cellular process
GO:0010799	0.692	regulation of peptidyl-threonine phosphorylation
GO:0032502	0.658	developmental process
GO:0032501	0.656	multicellular organismal process
GO:0045595	0.600	regulation of cell differentiation
GO:1901796	0.578	regulation of signal transduction by p53 class mediator
GO:0043535	0.533	regulation of blood vessel endothelial cell migration
GO:2001020	0.498	regulation of response to DNA damage stimulus
GO:0048856	0.494	anatomical structure development
GO:0030336	0.470	negative regulation of cell migration
GO:0090311	0.465	regulation of protein deacetylation
GO:0010633	0.447	negative regulation of epithelial cell migration
GO:0009893	0.441	positive regulation of metabolic process
GO:0070372	0.434	regulation of ERK1 and ERK2 cascade
GO:0090287	0.427	regulation of cellular response to growth factor stimulus
GO:0007275	0.427	multicellular organism development
GO:0050896	0.405	response to stimulus
GO:0051173	0.384	positive regulation of nitrogen compound metabolic process
GO:0010604	0.384	positive regulation of macromolecule metabolic process
GO:0010717	0.340	regulation of epithelial to mesenchymal transition
GO:0030856	0.339	regulation of epithelial cell differentiation
GO:0048731	0.310	system development
GO:0048584	0.307	positive regulation of response to stimulus
GO:0030857	0.307	negative regulation of epithelial cell differentiation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005654	0.999	nucleoplasm
GO:0005829	0.997	cytosol
GO:0031982	0.955	vesicle
GO:0097708	0.945	intracellular vesicle
GO:0031410	0.938	cytoplasmic vesicle
GO:0032991	0.524	protein-containing complex
GO:0012505	0.339	endomembrane system

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]