StarFunc result for job id Q7Z6A9

User Input

>input (289 residues)
MKTLPAMLGTGKLFWVFFLIPYLDIWNIHGKESCDVQLYIKRQSEHSILAGDPFELECPV
KYCANRPHVTWCKLNGTTCVKLEDRQTSWKEEKNISFFILHFEPVLPNDNGSYRCSANFQ
SNLIESHSTTLYVTDVKSASERPSKDEMASRPWLLYRLLPLGGLPLLITTCFCLFCCLRR
HQGKQNELSDTAGREINLVDAHLKSEQTEASTRQNSQVLLSETGIYDNDPDLCFRMQEGS
EVYSNPCLEENKPGIVYASLNHSVIGPNSRLARNVKEAPTEYASICVRS

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6A9	1.000	1.000	2.584E-49	289	1.000	1.000	Q7Z6A9.pdb.gz	BTLA_HUMAN B- and T-lymphocyte attenuator OS=Homo sapiens OX=9606 GN=BTLA PE=1 SV=3
2	AFDB:D3ZIN8	0.299	0.301	4.983E-9	287	0.142	0.143	D3ZIN8.pdb.gz	D3ZIN8_RAT Programmed cell death 1 OS=Rattus norvegicus OX=10116 GN=Pdcd1 PE=4 SV=1
3	AFDB:Q02242	0.296	0.296	5.269E-9	288	0.149	0.149	Q02242.pdb.gz	PDCD1_MOUSE Programmed cell death protein 1 OS=Mus musculus OX=10090 GN=Pdcd1 PE=1 SV=1
4	AFDB:Q86YW5	0.270	0.253	1.027E-8	311	0.170	0.158	Q86YW5.pdb.gz	TRML1_HUMAN Trem-like transcript 1 protein OS=Homo sapiens OX=9606 GN=TREML1 PE=1 SV=2
5	AFDB:Q9D659	0.295	0.279	1.027E-8	308	0.156	0.146	Q9D659.pdb.gz	VISTA_MOUSE V-type immunoglobulin domain-containing suppressor of T-cell activation OS=Mus musculus OX=10090 GN=Vsir PE=1 SV=2
6	AFDB:B3DGS1	0.300	0.187	1.148E-8	481	0.149	0.089	B3DGS1.pdb.gz
7	AFDB:Q9NTN9	0.248	0.096	1.434E-8	838	0.173	0.060	Q9NTN9.pdb.gz	SEM4G_HUMAN Semaphorin-4G OS=Homo sapiens OX=9606 GN=SEMA4G PE=1 SV=1
8	AFDB:O95297	0.318	0.335	1.603E-8	269	0.142	0.152	O95297.pdb.gz	MPZL1_HUMAN Myelin protein zero-like protein 1 OS=Homo sapiens OX=9606 GN=MPZL1 PE=1 SV=1
9	AFDB:Q15116	0.293	0.294	1.603E-8	288	0.142	0.142	Q15116.pdb.gz	PDCD1_HUMAN Programmed cell death protein 1 OS=Homo sapiens OX=9606 GN=PDCD1 PE=1 SV=3
10	AFDB:Q9VT83	0.308	0.230	3.906E-8	408	0.114	0.081	Q9VT83.pdb.gz	Q9VT83_DROME Defective proboscis extension response 10, isoform A OS=Drosophila melanogaster OX=7227 GN=dpr10 PE=1 SV=2
11	PDB:4edqA	0.312	0.194	2.031E-6	483	0.066	0.039	4edqA.pdb.gz	MBP-fusion protein of myosin-binding protein c residues 149-269
12	PDB:8e4cC	0.276	0.525	4.679E-6	142	0.097	0.197	8e4cC.pdb.gz
13	PDB:2cd0A	0.277	0.647	9.124E-6	111	0.059	0.153	2cd0A.pdb.gz
14	PDB:1cd0A	0.273	0.634	1.078E-5	111	0.059	0.153	1cd0A.pdb.gz
15	PDB:5ir3A	0.281	0.661	1.078E-5	111	0.059	0.153	5ir3A.pdb.gz
16	PDB:1jv5A	0.276	0.691	1.592E-5	107	0.059	0.159	1jv5A.pdb.gz
17	PDB:6xdsA	0.278	0.174	1.988E-5	485	0.059	0.035	6xdsA.pdb.gz	Development of a robust crystallization platform for immune receptor TREM2 using a crystallization chaperone strategy.
18	PDB:6sm1A	0.252	0.580	2.777E-5	111	0.052	0.135	6sm1A.pdb.gz	Fatal amyloid formation in a patient's antibody light chain is caused by a single point mutation.
19	PDB:1kcsL	0.274	0.362	4.844E-5	214	0.069	0.093	1kcsL.pdb.gz	Epitope recognition by diverse antibodies suggests conformational convergence in an antibody response.
20	PDB:4aizA	0.259	0.624	5.724E-5	107	0.059	0.159	4aizA.pdb.gz	Site-Directed Mutagenesis Reveals Regions Implicated in the Stability and Fiber Formation of Human Lambda3R Light Chains.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z6A9	0.0	604	289	1.000	1.000	BTLA_HUMAN B- and T-lymphocyte attenuator OS=Homo sapiens OX=9606 GN=BTLA PE=1 SV=3
2	Q7TSA3	1.49e-76	237	306	0.529	0.500	BTLA_MOUSE B- and T-lymphocyte attenuator OS=Mus musculus OX=10090 GN=Btla PE=1 SV=2
3	O01761	0.007	40.4	8081	0.087	0.003	UNC89_CAEEL Muscle M-line assembly protein unc-89 OS=Caenorhabditis elegans OX=6239 GN=unc-89 PE=1 SV=3
4	Q961I4	0.020	38.5	298	0.114	0.111	Q961I4_DROME GH21853p OS=Drosophila melanogaster OX=7227 GN=Bsg PE=2 SV=1
5	Q8IPG9	0.022	38.1	265	0.100	0.109	Q8IPG9_DROME Basigin, isoform A OS=Drosophila melanogaster OX=7227 GN=Bsg PE=1 SV=1
6	M9PCW5	0.025	38.1	266	0.100	0.109	M9PCW5_DROME Basigin, isoform J OS=Drosophila melanogaster OX=7227 GN=Bsg PE=1 SV=1
7	Q9QUM4	0.079	36.6	343	0.173	0.146	SLAF1_MOUSE Signaling lymphocytic activation molecule OS=Mus musculus OX=10090 GN=Slamf1 PE=1 SV=1
8	Q7KTJ7	0.094	36.6	648	0.114	0.051	Q7KTJ7_DROME Basigin, isoform G OS=Drosophila melanogaster OX=7227 GN=Bsg PE=1 SV=1
9	G5ED27	0.17	36.2	5175	0.073	0.004	G5ED27_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
10	G5EDG4	0.17	36.2	3962	0.073	0.005	G5EDG4_CAEEL Ig-like domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=2
11	G5EG33	0.17	36.2	5198	0.073	0.004	G5EG33_CAEEL Hemicentin OS=Caenorhabditis elegans OX=6239 GN=him-4 PE=1 SV=1
12	B3DKP1	0.22	35.8	1272	0.080	0.018	B3DKP1_DANRE receptor protein-tyrosine kinase OS=Danio rerio OX=7955 GN=VEGFR1 PE=2 SV=1
13	A5PLE7	0.25	35.0	368	0.062	0.049	GP83A_DANRE G-protein coupled receptor 183-A OS=Danio rerio OX=7955 GN=gpr183a PE=2 SV=1
14	P32249	0.35	34.7	361	0.069	0.055	GP183_HUMAN G-protein coupled receptor 183 OS=Homo sapiens OX=9606 GN=GPR183 PE=1 SV=3
15	Q3U6B2	0.53	33.9	357	0.073	0.059	GP183_MOUSE G-protein coupled receptor 183 OS=Mus musculus OX=10090 GN=Gpr183 PE=1 SV=1
16	P70232	0.57	34.3	1209	0.104	0.025	NCHL1_MOUSE Neural cell adhesion molecule L1-like protein OS=Mus musculus OX=10090 GN=Chl1 PE=1 SV=2
17	A0A8I6ASH2	0.68	34.3	4387	0.121	0.008	A0A8I6ASH2_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
18	A0A8I6A2S5	0.72	34.3	4402	0.121	0.008	A0A8I6A2S5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=1
19	F1LTJ5	1.1	33.5	2438	0.121	0.014	F1LTJ5_RAT Heparan sulfate proteoglycan 2 OS=Rattus norvegicus OX=10116 GN=Hspg2 PE=1 SV=4
20	P98160	1.3	33.1	4391	0.093	0.006	PGBM_HUMAN Basement membrane-specific heparan sulfate proteoglycan core protein OS=Homo sapiens OX=9606 GN=HSPG2 PE=1 SV=4

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF07679 I-set	0.33	22.4	Immunoglobulin I-set domain
2	PF00047 ig	0.029	25.9	Immunoglobulin domain
3	PF13895 Ig_2	0.62	21.7	Immunoglobulin domain
4	PF13927 Ig_3	0.00098	31.0	Immunoglobulin domain
5	PF07686 V-set	0.18	23.4	Immunoglobulin V-set domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000333919

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000347948	0.999	Tumor necrosis factor receptor superfamily member 14
2	9606.ENSP00000358470	0.979	V-set domain-containing T-cell activation inhibitor 1
3	9606.ENSP00000376345	0.974	Growth factor receptor-bound protein 2
4	9606.ENSP00000340944	0.948	Tyrosine-protein phosphatase non-receptor type 11
5	9606.ENSP00000235933	0.859	CD160 antigen
6	9606.ENSP00000391592	0.819	Tyrosine-protein phosphatase non-receptor type 6
7	9606.ENSP00000312002	0.809	Hepatitis A virus cellular receptor 2
8	9606.ENSP00000203629	0.802	Lymphocyte activation gene 3 protein
9	9606.ENSP00000354782	0.780	T-cell surface glycoprotein CD3 zeta chain
10	9606.ENSP00000303939	0.773	Cytotoxic T-lymphocyte protein 4
11	9606.ENSP00000370989	0.770	Programmed cell death 1 ligand 1
12	9606.ENSP00000357103	0.743	Atypical chemokine receptor 1
13	9606.ENSP00000011653	0.741	T-cell surface glycoprotein CD4
14	9606.ENSP00000386559	0.735	T-cell surface glycoprotein CD8 alpha chain
15	9606.ENSP00000469049	0.730	Tumor necrosis factor ligand superfamily member 14
16	9606.ENSP00000419085	0.717	T-cell immunoreceptor with Ig and ITIM domains
17	9606.ENSP00000335062	0.708	Programmed cell death protein 1
18	9606.ENSP00000380855	0.687	Programmed cell death 1 ligand 2
19	9606.ENSP00000338010	0.665	Interleukin-21 receptor
20	9606.ENSP00000216223	0.661	Interleukin-2 receptor subunit beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0051249	0.996	regulation of lymphocyte activation
GO:0007154	0.993	cell communication
GO:0050896	0.992	response to stimulus
GO:0023052	0.992	signaling
GO:1903037	0.986	regulation of leukocyte cell-cell adhesion
GO:0050776	0.976	regulation of immune response
GO:0042127	0.973	regulation of cell population proliferation
GO:0048519	0.972	negative regulation of biological process
GO:0050863	0.969	regulation of T cell activation
GO:0007165	0.965	signal transduction
GO:0051250	0.962	negative regulation of lymphocyte activation
GO:0070663	0.956	regulation of leukocyte proliferation
GO:0050670	0.951	regulation of lymphocyte proliferation
GO:0048518	0.876	positive regulation of biological process
GO:0008285	0.790	negative regulation of cell population proliferation
GO:0007166	0.721	cell surface receptor signaling pathway
GO:0048522	0.706	positive regulation of cellular process
GO:0019222	0.532	regulation of metabolic process
GO:0060255	0.510	regulation of macromolecule metabolic process
GO:0042129	0.456	regulation of T cell proliferation
GO:0002376	0.449	immune system process
GO:1903038	0.445	negative regulation of leukocyte cell-cell adhesion
GO:0050868	0.432	negative regulation of T cell activation
GO:0032945	0.427	negative regulation of mononuclear cell proliferation
GO:0050672	0.416	negative regulation of lymphocyte proliferation
GO:0002768	0.415	immune response-regulating cell surface receptor signaling pathway
GO:0002684	0.395	positive regulation of immune system process
GO:0010468	0.381	regulation of gene expression
GO:0032501	0.362	multicellular organismal process
GO:0009893	0.355	positive regulation of metabolic process
GO:0001817	0.347	regulation of cytokine production
GO:0051240	0.333	positive regulation of multicellular organismal process
GO:0048584	0.311	positive regulation of response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005886	1.000	plasma membrane
GO:0005622	0.545	intracellular anatomical structure
GO:0043226	0.536	organelle
GO:0043227	0.463	membrane-bounded organelle
GO:0005829	0.313	cytosol

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]