StarFunc result for job id Q7Z6B7

User Input

>input (1085 residues)
MSTPSRFKKDKEIIAEYESQVKEIRAQLVEQQKCLEQQTEMRVQLLQDLQDFFRKKAEIE
TEYSRNLEKLAERFMAKTRSTKDHQQYKKDQNLLSPVNCWYLLLNQVRRESKDHATLSDI
YLNNVIMRFMQISEDSTRMFKKSKEIAFQLHEDLMKVLNELYTVMKTYHMYHAESISAES
KLKEAEKQEEKQIGRSGDPVFHIRLEERHQRRSSVKKIEKMKEKRQAKYSENKLKSIKAR
NEYLLTLEATNASVFKYYIHDLSDLIDCCDLGYHASLNRALRTYLSAEYNLETSRHEGLD
IIENAVDNLEPRSDKQRFMEMYPAAFCPPMKFEFQSHMGDEVCQVSAQQPVQAELMLRYQ
QLQSRLATLKIENEEVKKTTEATLQTIQDMVTIEDYDVSECFQHSRSTESVKSTVSETYL
SKPSIAKRRANQQETEQFYFMKLREYLEGSNLITKLQAKHDLLQRTLGEGHRAEYMTTRP
PNVPPKPQKHRKSRPRSQYNTKLFNGDLETFVKDSGQVIPLIVESCIRFINLYGLQHQGI
FRVSGSQVEVNDIKNSFERGENPLADDQSNHDINSVAGVLKLYFRGLENPLFPKERFNDL
ISCIRIDNLYERALHIRKLLLTLPRSVLIVMRYLFAFLNHLSQYSDENMMDPYNLAICFG
PTLMPVPEIQDQVSCQAHVNEIIKTIIIHHETIFPDAKELDGPVYEKCMAGDDYCDSPYS
EHGTLEEVDQDAGTEPHTSEDECEPIEAIAKFDYVGRSARELSFKKGASLLLYHRASEDW
WEGRHNGIDGLVPHQYIVVQDMDDTFSDTLSQKADSEASSGPVTEDKSSSKDMNSPTDRH
PDGYLARQRKRGEPPPPVRRPGRTSDGHCPLHPPHALSNSSVDLGSPSLASHPRGLLQNR
GLNNDSPERRRRPGHGSLTNISRHDSLKKIDSPPIRRSTSSGQYTGFNDHKPLDPETIAQ
DIEETMNTALNELRELERQSTAKHAPDVVLDTLEQVKNSPTPATSTESLSPLHNVALRSS
EPQIRRSTSSSSDTMSTFKPMVAPRMGVQLKPPALRPKPAVLPKTNPTIGPAPPPQGPTD
KSCTM

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6B7	0.999	0.999	0.000	1085	1.000	1.000	Q7Z6B7.pdb.gz	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
2	AFDB:Q91Z69	0.477	0.487	0.000	1062	0.949	0.970	Q91Z69.pdb.gz	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
3	AFDB:O43295	0.439	0.433	4.163E-98	1099	0.688	0.679	O43295.pdb.gz	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
4	AFDB:D4A208	0.452	0.457	1.525E-92	1071	0.667	0.676	D4A208.pdb.gz	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
5	AFDB:P98171	0.413	0.470	2.367E-61	946	0.380	0.436	P98171.pdb.gz	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
6	AFDB:Q54DW4	0.174	0.141	6.723E-15	1350	0.125	0.101	Q54DW4.pdb.gz	Q54DW4_DICDI Pleckstrin domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=xacA PE=4 SV=1
7	AFDB:Q8N264	0.177	0.253	5.779E-12	748	0.105	0.152	Q8N264.pdb.gz	RHG24_HUMAN Rho GTPase-activating protein 24 OS=Homo sapiens OX=9606 GN=ARHGAP24 PE=1 SV=2
8	AFDB:Q7Z5H3	0.172	0.265	6.309E-12	698	0.114	0.178	Q7Z5H3.pdb.gz	RHG22_HUMAN Rho GTPase-activating protein 22 OS=Homo sapiens OX=9606 GN=ARHGAP22 PE=1 SV=1
9	AFDB:P42331	0.177	0.294	2.515E-10	645	0.082	0.138	P42331.pdb.gz	RHG25_HUMAN Rho GTPase-activating protein 25 OS=Homo sapiens OX=9606 GN=ARHGAP25 PE=1 SV=2
10	AFDB:A7KAX9	0.178	0.095	3.900E-10	2087	0.113	0.059	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
11	PDB:6r3vA	0.174	0.898	4.969E-10	198	0.046	0.253	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
12	PDB:3cxlA	0.172	0.451	1.048E-9	402	0.059	0.159	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
13	PDB:1xa6A	0.172	0.458	1.697E-9	399	0.058	0.158	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
14	PDB:5jcpA	0.149	0.436	7.556E-7	361	0.034	0.102	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
15	PDB:5c2kA	0.157	0.430	9.409E-7	382	0.043	0.123	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:3hajA	0.150	0.459	9.019E-5	286	0.042	0.161	3hajA.pdb.gz	Molecular mechanism of membrane constriction and tubulation mediated by the F-BAR protein Pacsin/Syndapin.
17	PDB:3qwyA	0.050	0.316	8.450E-4	170	0.017	0.106	3qwyA.pdb.gz
18	PDB:6ikoA	0.159	0.463	1.632E-3	303	0.041	0.145	6ikoA.pdb.gz
19	PDB:2dybA	0.054	0.187	3.595E-3	298	0.020	0.074	2dybA.pdb.gz
20	PDB:1k9aB	0.049	0.119	4.100E-3	441	0.014	0.034	1k9aB.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0G2JVF0	0.0	754	965	0.359	0.404	A0A0G2JVF0_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=1 SV=2
2	A0A286YEY3	0.0	728	459	0.329	0.778	A0A286YEY3_HUMAN SLIT-ROBO Rho GTPase activating protein 2B OS=Homo sapiens OX=9606 GN=SRGAP2B PE=1 SV=1
3	A0A8I5ZY52	0.0	726	921	0.348	0.410	A0A8I5ZY52_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
4	A0A8I6AIK5	0.0	736	934	0.352	0.409	A0A8I6AIK5_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1
5	B7ZM87	0.0	1467	1070	0.677	0.687	B7ZM87_HUMAN SLIT-ROBO Rho GTPase activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
6	D4A208	0.0	1461	1071	0.673	0.682	SRGP2_RAT SLIT-ROBO Rho GTPase-activating protein 2 OS=Rattus norvegicus OX=10116 GN=Srgap2 PE=1 SV=1
7	E7EQN5	0.0	783	925	0.357	0.418	E7EQN5_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
8	O43295	0.0	1475	1099	0.684	0.675	SRGP3_HUMAN SLIT-ROBO Rho GTPase-activating protein 3 OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=3
9	O75044	0.0	1462	1071	0.677	0.686	SRGP2_HUMAN SLIT-ROBO Rho GTPase-activating protein 2 OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=3
10	P0DJJ0	0.0	719	459	0.325	0.769	SRG2C_HUMAN SLIT-ROBO Rho GTPase-activating protein 2C OS=Homo sapiens OX=9606 GN=SRGAP2C PE=1 SV=1
11	P98171	0.0	809	946	0.363	0.416	RHG04_HUMAN Rho GTPase-activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=2
12	Q5VZB4	0.0	656	450	0.293	0.707	Q5VZB4_HUMAN SLIT-ROBO Rho GTPase activating protein 2 (Fragment) OS=Homo sapiens OX=9606 GN=SRGAP2 PE=1 SV=1
13	Q7Z6B7	0.0	2263	1085	1.000	1.000	SRGP1_HUMAN SLIT-ROBO Rho GTPase-activating protein 1 OS=Homo sapiens OX=9606 GN=SRGAP1 PE=1 SV=1
14	Q812A2	0.0	1477	1099	0.684	0.675	SRGP3_MOUSE SLIT-ROBO Rho GTPase-activating protein 3 OS=Mus musculus OX=10090 GN=Srgap3 PE=1 SV=1
15	Q8K4G7	0.0	754	965	0.359	0.404	Q8K4G7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=2 SV=1
16	Q91Z67	0.0	1460	1071	0.674	0.683	SRGP2_MOUSE SLIT-ROBO Rho GTPase-activating protein 2 OS=Mus musculus OX=10090 GN=Srgap2 PE=1 SV=2
17	Q91Z69	0.0	2137	1062	0.952	0.973	SRGP1_MOUSE SLIT-ROBO Rho GTPase-activating protein 1 OS=Mus musculus OX=10090 GN=Srgap1 PE=1 SV=2
18	Q8IXS7	7.40e-174	514	335	0.229	0.740	Q8IXS7_HUMAN SRGAP3 protein OS=Homo sapiens OX=9606 GN=SRGAP3 PE=1 SV=1
19	E9PCM6	2.22e-152	474	768	0.216	0.305	E9PCM6_HUMAN Rho GTPase activating protein 4 OS=Homo sapiens OX=9606 GN=ARHGAP4 PE=1 SV=1
20	A0A8I6GIQ7	1.16e-142	449	770	0.213	0.300	A0A8I6GIQ7_RAT Rho GTPase activating protein 4 OS=Rattus norvegicus OX=10116 GN=Arhgap4 PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00611 FCH	3.2e-17	74.0	Fes/CIP4, and EFC/F-BAR homology domain
2	PF03867 FTZ	4	18.5	Fushi tarazu (FTZ), N-terminal region
3	PF00620 RhoGAP	2.2e-41	152.6	RhoGAP domain
4	PF00018 SH3_1	1.8e-06	38.7	SH3 domain
5	PF07653 SH3_2	5.4e-05	34.2	Variant SH3 domain
6	PF14604 SH3_9	2.8e-06	38.5	Variant SH3 domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 60711.ENSCSAP00000000835

Rank	PPI partner	STRING score	Description
1	60711.ENSCSAP00000017098	0.953	Uncharacterized protein
2	60711.ENSCSAP00000002173	0.952	Uncharacterized protein
3	60711.ENSCSAP00000002171	0.896	Roundabout, axon guidance receptor, homolog 2 (Drosophila)
4	60711.ENSCSAP00000011012	0.890	annotation not available
5	60711.ENSCSAP00000006989	0.820	SLIT-ROBO Rho GTPase activating protein 3
6	60711.ENSCSAP00000011176	0.771	Ras homolog family member A
7	60711.ENSCSAP00000002207	0.770	annotation not available
8	60711.ENSCSAP00000013494	0.717	Rho guanine nucleotide exchange factor (GEF) 7
9	60711.ENSCSAP00000003911	0.692	Belongs to the protein kinase superfamily.
10	60711.ENSCSAP00000013984	0.670	Proline-serine-threonine phosphatase interacting protein 2
11	60711.ENSCSAP00000006357	0.659	Growth arrest-specific 7
12	60711.ENSCSAP00000016423	0.652	Ras homolog family member C
13	60711.ENSCSAP00000014031	0.647	BCL2/adenovirus E1B 19kD interacting protein like
14	60711.ENSCSAP00000001794	0.632	FCH domain only 1
15	60711.ENSCSAP00000012275	0.631	Rho GTPase activating protein 15
16	60711.ENSCSAP00000002193	0.620	Slit homolog 1 (Drosophila)
17	60711.ENSCSAP00000004709	0.620	Intersectin 2
18	60711.ENSCSAP00000006135	0.620	Intersectin 1 (SH3 domain protein)
19	60711.ENSCSAP00000018874	0.608	Exocyst complex component 8
20	60711.ENSCSAP00000012190	0.596	Rho family GTPase 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	0.999	protein binding
GO:0005096	0.999	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0009987	0.988	cellular process
GO:0016477	0.945	cell migration
GO:0050896	0.807	response to stimulus
GO:0016043	0.727	cellular component organization
GO:0035556	0.714	intracellular signal transduction
GO:0048583	0.711	regulation of response to stimulus
GO:0051056	0.672	regulation of small GTPase mediated signal transduction
GO:0032501	0.547	multicellular organismal process
GO:0048856	0.546	anatomical structure development
GO:0040012	0.514	regulation of locomotion
GO:0007275	0.485	multicellular organism development
GO:2000145	0.464	regulation of cell motility
GO:0048519	0.440	negative regulation of biological process
GO:0048523	0.403	negative regulation of cellular process
GO:0048731	0.370	system development
GO:0048518	0.348	positive regulation of biological process
GO:0007264	0.337	small GTPase mediated signal transduction
GO:0030334	0.328	regulation of cell migration
GO:0051128	0.317	regulation of cellular component organization
GO:0048522	0.307	positive regulation of cellular process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	1.000	cytosol
GO:0043227	0.956	membrane-bounded organelle
GO:0043229	0.933	intracellular organelle
GO:0043231	0.867	intracellular membrane-bounded organelle
GO:0016020	0.851	membrane
GO:0005634	0.766	nucleus
GO:0043233	0.385	organelle lumen
GO:0070013	0.371	intracellular organelle lumen

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]