StarFunc result for job id Q7Z6E9

User Input

>input (1792 residues)
MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDD
NALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAIDDSSASISLAQLTKTANL
AEANASEEDKIKAMMSQSGHEYDPINYMKKPLGPPPPSYTCFRCGKPGHYIKNCPTNGDK
NFESGPRIKKSTGIPRSFMMEVKDPNMKGAMLTNTGKYAIPTIDAEAYAIGKKEKPPFLP
EEPSSSSEEDDPIPDELLCLICKDIMTDAVVIPCCGNSYCDECIRTALLESDEHTCPTCH
QNDVSPDALIANKFLRQAVNNFKNETGYTKRLRKQLPPPPPPIPPPRPLIQRNLQPLMRS
PISRQQDPLMIPVTSSSTHPAPSISSLTSNQSSLAPPVSGNPSSAPAPVPDITATVSISV
HSEKSDGPFRDSDNKILPAAALASEHSKGTSSIAITALMEEKGYQVPVLGTPSLLGQSLL
HGQLIPTTGPVRINTARPGGGRPGWEHSNKLGYLVSPPQQIRRGERSCYRSINRGRHHSE
RSQRTQGPSLPATPVFVPVPPPPLYPPPPHTLPLPPGVPPPQFSPQFPPGQPPPAGYSVP
PPGFPPAPANLSTPWVSSGVQTAHSNTIPTTQAPPLSREEFYREQRRLKEEEKKKSKLDE
FTNDFAKELMEYKKIQKERRRSFSRSKSPYSGSSYSRSSYTYSKSRSGSTRSRSYSRSFS
RSHSRSYSRSPPYPRRGRGKSRNYRSRSRSHGYHRSRSRSPPYRRYHSRSRSPQAFRGQS
PNKRNVPQGETEREYFNRYREVPPPYDMKAYYGRSVDFRDPFEKERYREWERKYREWYEK
YYKGYAAGAQPRPSANRENFSPERFLPLNIRNSPFTRGRREDYVGGQSHRSRNIGSNYPE
KLSARDGHNQKDNTKSKEKESENAPGDGKGNKHKKHRKRRKGEESEGFLNPELLETSRKS
REPTGVEENKTDSLFVLPSRDDATPVRDEPMDAESITFKSVSEKDKRERDKPKAKGDKTK
RKNDGSAVSKKENIVKPAKGPQEKVDGERERSPRSEPPIKKAKEETPKTDNTKSSSSSQK
DEKITGTPRKAHSKSAKEHQETKPVKEEKVKKDYSKDVKSEKLTTKEEKAKKPNEKNKPL
DNKGEKRKRKTEEKGVDKDFESSSMKISKLEVTEIVKPSPKRKMEPDTEKMDRTPEKDKI
SLSAPAKKIKLNRETGKKIGSTENISNTKEPSEKLESTSSKVKQEKVKGKVRRKVTGTEG
SSSTLVDYTSTSSTGGSPVRKSEEKTDTKRTVIKTMEEYNNDNTAPAEDVIIMIQVPQSK
WDKDDFESEEEDVKSTQPISSVGKPASVIKNVSTKPSNIVKYPEKESEPSEKIQKFTKDV
SHEIIQHEVKSSKNSASSEKGKTKDRDYSVLEKENPEKRKNSTQPEKESNLDRLNEQGNF
KSLSQSSKEARTSDKHDSTRASSNKDFTPNRDKKTDYDTREYSSSKRRDEKNELTRRKDS
PSRNKDSASGQKNKPREERDLPKKGTGDSKKSNSSPSRDRKPHDHKATYDTKRPNEETKS
VDKNPCKDREKHVLEARNNKESSGNKLLYILNPPETQVEKEQITGQIDKSTVKPKPQLSH
SSRLSSDLTRETDEAAFEPDYNESDSESNVSVKEEESSGNISKDLKDKIVEKAKESLDTA
AVVQVGISRNQSHSSPSVSPSRSHSPSGSQTRSHSSSASSAESQDSKKKKKKKEKKKHKK
HKKHKKHKKHAGTEVELEKSQKHKHKKKKSKKNKDKEKEKEKDDQKVKSVTV

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P97868	0.195	0.195	0.000	1790	0.886	0.887	P97868.pdb.gz	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
2	AFDB:Q7Z6E9	0.999	0.999	0.000	1792	1.000	1.000	Q7Z6E9.pdb.gz	RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1
3	AFDB:Q9XZ21	0.076	0.104	8.894E-36	1231	0.170	0.247	Q9XZ21.pdb.gz	Q9XZ21_DROME Something that sticks like glue, isoform A OS=Drosophila melanogaster OX=7227 GN=snama PE=1 SV=1
4	AFDB:P48754	0.046	0.045	1.325E-5	1812	0.130	0.129	P48754.pdb.gz	BRCA1_MOUSE Breast cancer type 1 susceptibility protein homolog OS=Mus musculus OX=10090 GN=Brca1 PE=1 SV=3
5	AFDB:P38398	0.054	0.052	1.259E-4	1863	0.137	0.132	P38398.pdb.gz	BRCA1_HUMAN Breast cancer type 1 susceptibility protein OS=Homo sapiens OX=9606 GN=BRCA1 PE=1 SV=2
6	PDB:4r8pL	0.040	0.267	1.485E-4	254	0.013	0.094	4r8pL.pdb.gz	Crystal structure of the PRC1 ubiquitylation module bound to the nucleosome.
7	AFDB:P35658	0.030	0.027	1.796E-4	2090	0.123	0.106	P35658.pdb.gz	NU214_HUMAN Nuclear pore complex protein Nup214 OS=Homo sapiens OX=9606 GN=NUP214 PE=1 SV=2
8	AFDB:O77086	0.028	0.030	2.562E-4	1571	0.086	0.098	O77086.pdb.gz	C3G_DROME Guanine nucleotide-releasing factor 2 OS=Drosophila melanogaster OX=7227 GN=C3G PE=1 SV=4
9	AFDB:A1Z8R2	0.033	0.043	2.718E-4	1199	0.092	0.138	A1Z8R2.pdb.gz	A1Z8R2_DROME ADD domain-containing protein 1, isoform A OS=Drosophila melanogaster OX=7227 GN=ADD1 PE=1 SV=1
10	PDB:3m62A	0.040	0.074	1.180E-3	955	0.011	0.021	3m62A.pdb.gz
11	AFDB:Q99PP2	0.033	0.028	1.514E-3	2237	0.143	0.114	Q99PP2.pdb.gz	ZN318_MOUSE Zinc finger protein 318 OS=Mus musculus OX=10090 GN=Znf318 PE=1 SV=3
12	AFDB:Q5VUA4	0.041	0.035	2.581E-3	2279	0.152	0.119	Q5VUA4.pdb.gz	ZN318_HUMAN Zinc finger protein 318 OS=Homo sapiens OX=9606 GN=ZNF318 PE=1 SV=2
13	PDB:5dkaA	0.033	0.560	3.428E-3	96	0.008	0.156	5dkaA.pdb.gz	A C2HC zinc finger is essential for the RING-E2 interaction of the ubiquitin ligase RNF125.
14	PDB:2c2lA	0.043	0.262	3.859E-3	281	0.012	0.078	2c2lA.pdb.gz	Chaperoned Ubiquitylation-Crystal Structures of the Chip U Box E3 Ubiquitin Ligase and a Chip-Ubc13-Uev1A Complex
15	PDB:5gm6a	0.033	0.426	1.189E-2	123	0.015	0.211	5gm6a.pdb.gz	Structure of a yeast activated spliceosome at 3.5 angstrom resolution
16	PDB:7qcdC	0.038	0.228	1.507E-2	267	0.007	0.049	7qcdC.pdb.gz	Cryo-EM structure of the Smc5/6 holo-complex.
17	PDB:6yvaC	0.037	0.370	1.599E-2	155	0.007	0.077	6yvaC.pdb.gz
18	PDB:5mpoB	0.036	0.528	1.910E-2	84	0.010	0.214	5mpoB.pdb.gz
19	PDB:7vvbB	0.033	0.572	2.281E-2	77	0.003	0.078	7vvbB.pdb.gz	Structural insights into Ras regulation by SIN1.
20	PDB:3tixA	0.047	0.332	2.568E-2	153	0.009	0.105	3tixA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A2R8Y880	0.0	3483	1759	0.960	0.978	A0A2R8Y880_HUMAN RB binding protein 6, ubiquitin ligase (Fragment) OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1
2	P97868	0.0	2663	1790	0.835	0.836	RBBP6_MOUSE E3 ubiquitin-protein ligase RBBP6 OS=Mus musculus OX=10090 GN=Rbbp6 PE=1 SV=5
3	Q7Z6E9	0.0	3633	1792	1.000	1.000	RBBP6_HUMAN E3 ubiquitin-protein ligase RBBP6 OS=Homo sapiens OX=9606 GN=RBBP6 PE=1 SV=1
4	D5SHU1	1.73e-78	271	494	0.080	0.291	D5SHU1_DROME MIP16350p OS=Drosophila melanogaster OX=7227 GN=snama PE=1 SV=1
5	Q9XZ21	1.85e-76	281	1231	0.080	0.116	Q9XZ21_DROME Something that sticks like glue, isoform A OS=Drosophila melanogaster OX=7227 GN=snama PE=1 SV=1
6	O94264	3.17e-48	182	482	0.065	0.241	YORF_SCHPO Uncharacterized RING finger protein P8B7.15c OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=SPBP8B7.15c PE=4 SV=1
7	P35728	2.24e-40	158	441	0.060	0.245	MPE1_YEAST Protein MPE1 OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=MPE1 PE=1 SV=1
8	F4JP52	4.83e-40	163	826	0.062	0.136	PQT3_ARATH E3 ubiquitin ligase PARAQUAT TOLERANCE 3 OS=Arabidopsis thaliana OX=3702 GN=PQT3 PE=1 SV=1
9	H2KYH3	4.43e-06	54.7	2476	0.009	0.007	RING2_CAEEL E3 ubiquitin-protein ligase RING2 homolog spat-3 OS=Caenorhabditis elegans OX=6239 GN=spat-3 PE=3 SV=1
10	O14776	0.074	40.4	1098	0.021	0.034	TCRG1_HUMAN Transcription elongation regulator 1 OS=Homo sapiens OX=9606 GN=TCERG1 PE=1 SV=2
11	P25172	0.24	38.9	1368	0.008	0.011	SUZ2_DROME Protein suppressor 2 of zeste OS=Drosophila melanogaster OX=7227 GN=Su(z)2 PE=2 SV=2
12	P18583	4.9	34.7	2426	0.012	0.009	SON_HUMAN Protein SON OS=Homo sapiens OX=9606 GN=SON PE=1 SV=4
13	A0A0R4IVY5	6.5	34.3	1359	0.010	0.013	A0A0R4IVY5_DANRE Rho-associated protein kinase OS=Danio rerio OX=7955 GN=rock1 PE=1 SV=2
14	H7C1M2	8.8	33.9	1454	0.012	0.015	H7C1M2_HUMAN SON DNA and RNA binding protein (Fragment) OS=Homo sapiens OX=9606 GN=SON PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF08783 DWNN	4.7e-26	102.2	DWNN domain
2	PF04564 U-box	0.0031	29.0	U-box domain
3	PF00097 zf-C3HC4	1.9e+02	13.3	Zinc finger, C3HC4 type (RING finger)
4	PF13923 zf-C3HC4_2	0.039	25.1	Zinc finger, C3HC4 type (RING finger)
5	PF13920 zf-C3HC4_3	0.046	24.9	Zinc finger, C3HC4 type (RING finger)
6	PF00098 zf-CCHC	0.14	23.5	Zinc knuckle
7	PF13696 zf-CCHC_2	1.5e-05	36.0	Zinc knuckle
8	PF13639 zf-RING_2	25	16.7	Ring finger domain
9	PF14634 zf-RING_5	39	15.6	zinc-RING finger domain
10	PF13445 zf-RING_UBOX	86	14.6	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000317872

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000484669	0.992	Cleavage and polyadenylation specificity factor subunit 1
2	9606.ENSP00000298875	0.989	Cleavage and polyadenylation specificity factor subunit 2
3	9606.ENSP00000325377	0.989	pre-mRNA 3' end processing protein WDR33
4	9606.ENSP00000292476	0.988	Cleavage and polyadenylation specificity factor subunit 4
5	9606.ENSP00000269305	0.985	Cellular tumor antigen p53
6	9606.ENSP00000245934	0.980	Symplekin
7	9606.ENSP00000291386	0.977	RNA polymerase II subunit A C-terminal domain phosphatase SSU72
8	9606.ENSP00000296490	0.973	WD repeat-containing protein 82
9	9606.ENSP00000336752	0.971	Pre-mRNA 3'-end-processing factor FIP1
10	9606.ENSP00000358762	0.968	E3 ubiquitin-protein ligase E3D
11	9606.ENSP00000298281	0.961	Pre-mRNA cleavage complex 2 protein Pcf11
12	9606.ENSP00000238112	0.956	Cleavage and polyadenylation specificity factor subunit 3
13	9606.ENSP00000315791	0.925	Cleavage stimulation factor subunit 3
14	9606.ENSP00000362063	0.898	Cleavage stimulation factor subunit 2
15	9606.ENSP00000235090	0.885	Methylosome protein 50
16	9606.ENSP00000216277	0.875	Poly(A) polymerase alpha
17	9606.ENSP00000258149	0.854	E3 ubiquitin-protein ligase Mdm2
18	9606.ENSP00000326031	0.850	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
19	9606.ENSP00000238714	0.849	Poly(A) polymerase gamma
20	9606.ENSP00000384700	0.847	poly(A) polymerase beta

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0019901	1.000	protein kinase binding
GO:0003723	1.000	RNA binding
GO:0061630	1.000	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0071704	0.998	organic substance metabolic process
GO:0044238	0.997	primary metabolic process
GO:0044237	0.995	cellular metabolic process
GO:0006807	0.994	nitrogen compound metabolic process
GO:0043170	0.994	macromolecule metabolic process
GO:0019538	0.913	protein metabolic process
GO:0050794	0.896	regulation of cellular process
GO:0044260	0.837	cellular macromolecule metabolic process
GO:0009056	0.801	catabolic process
GO:0060255	0.791	regulation of macromolecule metabolic process
GO:0044248	0.766	cellular catabolic process
GO:0009057	0.766	macromolecule catabolic process
GO:0019219	0.756	regulation of nucleobase-containing compound metabolic process
GO:0006508	0.743	proteolysis
GO:1901565	0.735	organonitrogen compound catabolic process
GO:0030163	0.732	protein catabolic process
GO:0044265	0.690	cellular macromolecule catabolic process
GO:0006511	0.651	ubiquitin-dependent protein catabolic process
GO:0050896	0.476	response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0016607	1.000	nuclear speck
GO:0043232	0.986	intracellular non-membrane-bounded organelle
GO:0005829	0.984	cytosol
GO:0032991	0.966	protein-containing complex
GO:0005856	0.735	cytoskeleton
GO:0015630	0.607	microtubule cytoskeleton
GO:0005815	0.476	microtubule organizing center
GO:0005813	0.454	centrosome

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	1.000	Transferases.

[back to server]