StarFunc result for job id Q7Z6G3

User Input

>input (386 residues)
MCERAARLCRAGAHRLLREPPQQGRALGGLLRWVGARMGEPRESLAPAAPADPGPASPRG
GTAVILDIFRRADKNDDGKLSLEEFQLFFADGVLNEKELEDLFHTIDSDNTNHVDTKELC
DYFVDHMGDYEDVLASLETLNHSVLKAMGYTKKVYEGGSNVDQFVTRFLLKETANQIQSL
LSSVESAVEAIEEQTSQLRQNHIKPSHSAAQTWCGSPTPASAPNHKLMAMEQGKTLPSAT
EDAKEEGLEAQISRLAELIGRLESKALWFDLQQRLSDEDGTNMHLQLVRQEMAVCPEQLS
EFLDSLRQYLRGTTGVRNCFHITAVRLSDGFTFVIYEFWETEEAWKRHLQSPLCKAFRHV
KVDTLSQPEALSRILVPAAWCTVGRD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6G3	1.000	1.000	6.430E-69	386	1.000	1.000	Q7Z6G3.pdb.gz	NECA2_HUMAN N-terminal EF-hand calcium-binding protein 2 OS=Homo sapiens OX=9606 GN=NECAB2 PE=1 SV=1
2	AFDB:F1LQY6	0.685	0.680	3.452E-58	389	0.855	0.848	F1LQY6.pdb.gz	NECA2_RAT N-terminal EF-hand calcium-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Necab2 PE=1 SV=3
3	AFDB:Q8BG18	0.392	0.428	6.565E-34	352	0.399	0.438	Q8BG18.pdb.gz	NECA1_MOUSE N-terminal EF-hand calcium-binding protein 1 OS=Mus musculus OX=10090 GN=Necab1 PE=1 SV=1
4	AFDB:Q9D6J4	0.415	0.449	7.720E-33	353	0.376	0.411	Q9D6J4.pdb.gz	NECA3_MOUSE N-terminal EF-hand calcium-binding protein 3 OS=Mus musculus OX=10090 GN=Necab3 PE=2 SV=2
5	AFDB:Q96P71	0.459	0.449	2.236E-31	396	0.368	0.359	Q96P71.pdb.gz	NECA3_HUMAN N-terminal EF-hand calcium-binding protein 3 OS=Homo sapiens OX=9606 GN=NECAB3 PE=1 SV=2
6	AFDB:U3KQF5	0.272	0.784	4.310E-11	125	0.111	0.344	U3KQF5.pdb.gz	U3KQF5_HUMAN N-terminal EF-hand calcium binding protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=NECAB3 PE=1 SV=8
7	AFDB:P64461	0.223	0.850	5.094E-7	96	0.054	0.219	P64461.pdb.gz	LSRG_ECOLI (4S)-4-hydroxy-5-phosphonooxypentane-2,3-dione isomerase OS=Escherichia coli (strain K12) OX=83333 GN=lsrG PE=1 SV=1
8	AFDB:Q72EZ0	0.238	0.821	2.030E-6	106	0.026	0.094	Q72EZ0.pdb.gz	Q72EZ0_DESVH ABM domain-containing protein OS=Desulfovibrio vulgaris (strain ATCC 29579 / DSM 644 / NCIMB 8303 / VKM B-1760 / Hildenborough) OX=882 GN=DVU_0428 PE=1 SV=1
9	PDB:1tuvA	0.213	0.743	1.765E-5	103	0.044	0.165	1tuvA.pdb.gz	Structural and Biochemical Evidence for an Enzymatic Quinone Redox Cycle in Escherichia coli: IDENTIFICATION OF A NOVEL QUINOL MONOOXYGENASE
10	AFDB:O54259	0.237	0.707	5.215E-5	118	0.039	0.127	O54259.pdb.gz	SNOAB_STRNO Deoxynogalonate monooxygenase OS=Streptomyces nogalater OX=38314 GN=snoaB PE=1 SV=1
11	PDB:3kg0B	0.190	0.620	6.236E-5	98	0.036	0.143	3kg0B.pdb.gz
12	AFDB:O75323	0.206	0.272	7.944E-5	286	0.062	0.084	O75323.pdb.gz	NIPS2_HUMAN Protein NipSnap homolog 2 OS=Homo sapiens OX=9606 GN=NIPSNAP2 PE=1 SV=1
13	PDB:7w6dA	0.199	0.618	8.945E-5	104	0.036	0.135	7w6dA.pdb.gz	Dual Engineering of Olivetolic Acid Cyclase and Tetraketide Synthase to Generate Longer Alkyl-Chain Olivetolic Acid Analogs.
14	PDB:1q53A	0.204	0.579	2.639E-4	112	0.036	0.125	1q53A.pdb.gz
15	PDB:1rjjA	0.223	0.673	5.113E-4	111	0.036	0.126	1rjjA.pdb.gz
16	PDB:1a2xA	0.143	0.335	1.602E-3	158	0.065	0.158	1a2xA.pdb.gz	Crystal structure of troponin C in complex with troponin I fragment at 2.3-A resolution.
17	PDB:1x8dA	0.183	0.559	1.701E-3	104	0.034	0.125	1x8dA.pdb.gz	Structural Insights into the Monosaccharide Specificity of Escherichia coli Rhamnose Mutarotase
18	PDB:3j9zSF	0.170	0.406	1.919E-3	135	0.039	0.111	3j9zSF.pdb.gz	Activation of GTP hydrolysis in mRNA-tRNA translocation by elongation factor G.
19	PDB:2jt0A	0.151	0.335	2.591E-3	161	0.065	0.155	2jt0A.pdb.gz
20	PDB:7psqG	0.164	0.513	2.922E-3	108	0.044	0.157	7psqG.pdb.gz	Crystal structure of S100A4 labeled with NU074381b.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	F1LQY6	0.0	677	389	0.855	0.848	NECA2_RAT N-terminal EF-hand calcium-binding protein 2 OS=Rattus norvegicus OX=10116 GN=Necab2 PE=1 SV=3
2	Q7Z6G3	0.0	801	386	1.000	1.000	NECA2_HUMAN N-terminal EF-hand calcium-binding protein 2 OS=Homo sapiens OX=9606 GN=NECAB2 PE=1 SV=1
3	Q9ESB5	2.23e-94	288	352	0.396	0.435	NECA1_RAT N-terminal EF-hand calcium-binding protein 1 OS=Rattus norvegicus OX=10116 GN=Necab1 PE=1 SV=1
4	Q8BG18	2.62e-94	288	352	0.396	0.435	NECA1_MOUSE N-terminal EF-hand calcium-binding protein 1 OS=Mus musculus OX=10090 GN=Necab1 PE=1 SV=1
5	Q8N987	5.39e-93	284	351	0.394	0.433	NECA1_HUMAN N-terminal EF-hand calcium-binding protein 1 OS=Homo sapiens OX=9606 GN=NECAB1 PE=1 SV=1
6	Q9D6J4	2.41e-79	249	353	0.363	0.397	NECA3_MOUSE N-terminal EF-hand calcium-binding protein 3 OS=Mus musculus OX=10090 GN=Necab3 PE=2 SV=2
7	Q96P71	5.40e-77	245	396	0.381	0.371	NECA3_HUMAN N-terminal EF-hand calcium-binding protein 3 OS=Homo sapiens OX=9606 GN=NECAB3 PE=1 SV=2
8	U3KQF5	7.79e-21	89.4	125	0.119	0.368	U3KQF5_HUMAN N-terminal EF-hand calcium binding protein 3 (Fragment) OS=Homo sapiens OX=9606 GN=NECAB3 PE=1 SV=8
9	Q6GQS1	6.12e-04	44.3	467	0.085	0.071	SCMC3_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Mus musculus OX=10090 GN=Slc25a23 PE=1 SV=1
10	Q9BV35	8.63e-04	43.5	468	0.091	0.075	SCMC3_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A23 OS=Homo sapiens OX=9606 GN=SLC25A23 PE=1 SV=2
11	Q1ZXH5	0.001	41.2	157	0.067	0.166	Q1ZXH5_DICDI Calcium-binding EF-hand domain-containing protein OS=Dictyostelium discoideum OX=44689 GN=DDB_G0279681 PE=4 SV=1
12	Q54LX0	0.005	40.0	183	0.057	0.120	CBPM_DICDI Calcium-binding protein M OS=Dictyostelium discoideum OX=44689 GN=cbpM PE=1 SV=1
13	A2CEQ0	0.006	41.2	469	0.049	0.041	SCM2B_DANRE Calcium-binding mitochondrial carrier protein SCaMC-2-B OS=Danio rerio OX=7955 GN=slc25a25b PE=3 SV=2
14	Q8BMD8	0.006	41.2	475	0.067	0.055	SCMC1_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Mus musculus OX=10090 GN=Slc25a24 PE=1 SV=1
15	Q54GL7	0.010	37.0	73	0.047	0.247	MLCB_DICDI Myosin-IB light chain OS=Dictyostelium discoideum OX=44689 GN=mlcB PE=1 SV=1
16	Q6NUK1	0.019	39.3	477	0.047	0.038	SCMC1_HUMAN Mitochondrial adenyl nucleotide antiporter SLC25A24 OS=Homo sapiens OX=9606 GN=SLC25A24 PE=1 SV=2
17	A3FG33	0.050	38.5	2480	0.070	0.011	A3FG33_DANRE Alpha II-spectrin OS=Danio rerio OX=7955 GN=wu:fa20e05 PE=2 SV=1
18	Q587D7	0.056	38.1	673	0.114	0.065	Q587D7_TRYB2 Calmodulin, putative OS=Trypanosoma brucei brucei (strain 927/4 GUTat10.1) OX=185431 GN=Tb06.26G9.270 PE=4 SV=1
19	A2ASZ8	0.059	37.7	469	0.049	0.041	SCMC2_MOUSE Mitochondrial adenyl nucleotide antiporter SLC25A25 OS=Mus musculus OX=10090 GN=Slc25a25 PE=1 SV=1
20	Q91ZU6	0.10	37.4	7393	0.052	0.003	DYST_MOUSE Dystonin OS=Mus musculus OX=10090 GN=Dst PE=1 SV=2

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF03992 ABM	4.2e-10	50.9	Antibiotic biosynthesis monooxygenase
2	PF19103 DUF5790	1.4e+02	14.5	Family of unknown function (DUF5790)
3	PF00036 EF-hand_1	8.6e-06	36.0	EF hand
4	PF14788 EF-hand_10	8.3e+02	11.3	EF hand
5	PF13202 EF-hand_5	0.03	25.0	EF hand
6	PF13405 EF-hand_6	9.4e-05	33.0	EF-hand domain
7	PF13499 EF-hand_7	0.0095	27.7	EF-hand domain pair
8	PF13833 EF-hand_8	0.00018	32.5	EF-hand domain pair
9	PF18288 FAA_hydro_N_2	4.7e+02	12.6	Fumarylacetoacetase N-terminal domain 2
10	PF05911 FPP	16	15.3	Filament-like plant protein, long coiled-coil
11	PF14932 HAUS-augmin3	4.5e+02	11.7	HAUS augmin-like complex subunit 3
12	PF10591 SPARC_Ca_bdg	5.1e+02	12.4	Secreted protein acidic and rich in cysteine Ca binding region

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000307449

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000246190	0.703	N-terminal EF-hand calcium-binding protein 3
2	9606.ENSP00000299709	0.684	Putative sodium-coupled neutral amino acid transporter 8
3	9606.ENSP00000362563	0.678	Zinc finger and BTB domain-containing protein 43
4	9606.ENSP00000226760	0.621	Wolframin
5	9606.ENSP00000336630	0.612	Adenosine A2a receptor
6	9606.ENSP00000387380	0.566	N-terminal EF-hand calcium binding protein 1
7	9606.ENSP00000418575	0.555	Protein FAM19A1
8	9606.ENSP00000470383	0.530	Cytohesin-2
9	9606.ENSP00000439856	0.513	Calcium homeostasis endoplasmic reticulum protein
10	9606.ENSP00000260743	0.509	Calcium homeostasis modulator protein 2
11	9606.ENSP00000362041	0.505	DnaJ homolog subfamily C member 9
12	9606.ENSP00000404232	0.504	EF-hand domain-containing family member C2
13	9606.ENSP00000310661	0.503	cAMP-specific 3',5'-cyclic phosphodiesterase 7B
14	9606.ENSP00000358033	0.500	Decaprenyl-diphosphate synthase subunit 2

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0042802	1.000	identical protein binding
GO:0035254	1.000	glutamate receptor binding
GO:0001664	1.000	G protein-coupled receptor binding
GO:0031687	0.636	A2A adenosine receptor binding
GO:0031802	0.620	type 5 metabotropic glutamate receptor binding
GO:0003824	0.406	catalytic activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0050794	0.986	regulation of cellular process
GO:0048518	0.947	positive regulation of biological process
GO:0048519	0.924	negative regulation of biological process
GO:0032879	0.915	regulation of localization
GO:0048583	0.897	regulation of response to stimulus
GO:0051049	0.838	regulation of transport
GO:0023051	0.836	regulation of signaling
GO:0010646	0.836	regulation of cell communication
GO:0048522	0.820	positive regulation of cellular process
GO:0008277	0.769	regulation of G protein-coupled receptor signaling pathway
GO:0048523	0.749	negative regulation of cellular process
GO:0048259	0.737	regulation of receptor-mediated endocytosis
GO:0009967	0.672	positive regulation of signal transduction
GO:0043408	0.664	regulation of MAPK cascade
GO:0051051	0.648	negative regulation of transport
GO:0070372	0.621	regulation of ERK1 and ERK2 cascade
GO:1902533	0.610	positive regulation of intracellular signal transduction
GO:1905475	0.601	regulation of protein localization to membrane
GO:0045806	0.582	negative regulation of endocytosis
GO:0045745	0.501	positive regulation of G protein-coupled receptor signaling pathway
GO:0043410	0.494	positive regulation of MAPK cascade
GO:0009987	0.407	cellular process
GO:1903829	0.315	positive regulation of protein localization
GO:1905477	0.314	positive regulation of protein localization to membrane
GO:0002090	0.313	regulation of receptor internalization
GO:0048261	0.311	negative regulation of receptor-mediated endocytosis
GO:0070374	0.306	positive regulation of ERK1 and ERK2 cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005737	0.989	cytoplasm
GO:0016020	0.969	membrane
GO:0005886	0.962	plasma membrane
GO:0043226	0.836	organelle
GO:0043229	0.833	intracellular organelle
GO:0043227	0.831	membrane-bounded organelle
GO:0043231	0.810	intracellular membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]