StarFunc result for job id Q7Z6G8

User Input

>input (1248 residues)
MGKDQELLEAARTGNVALVEKLLSGRKGGILGGGSGPLPLSNLLSIWRGPNVNCTDSSGY
TALHHAALNGHKDIVLKLLQYEASTNVADNKGYFPIHLAAWKGDVEIVKILIHHGPSHSR
VNEQNNENETALHCAAQYGHSEVVAVLLEELTDPTIRNSKLETPLDLAALYGRLRVVKMI
ISAHPNLMSCNTRKHTPLHLAARNGHKAVVQVLLEAGMDVSCQTEKGSALHEAALFGKVD
VVRVLLETGIDANIKDSLGRTVLDILKEHPSQKSLQIATLLQEYLEGVGRSTVLEEPVQE
DATQETHISSPVESPSQKTKSETVTGELSKLLDEIKLCQEKDYSFEDLCHTISDHYLDNL
SKISEEELGKNGSQSVRTSSTINLSPGEVEEEDDDENTCGPSGLWEALTPCNGCRNLGFP
MLAQESYPKKRNYTMEIVPSASLDTFPSENENFLCDLMDTAVTKKPCSLEIARAPSPRTD
NASEVAVTTPGTSNHRNSSTGPTPDCSPPSPDTALKNIVKVIRPQPKQRTSIVSSLDFHR
MNHNQEYFEINTSTGCTSFTASPPASPPTSSVGTTEVKNEGTNHTDDLSRQDDNDPPKEY
DPGQFAGLLHGSSPACESPENPFHLYGKREQCEKGQDEVSLANSPLPFKQSPIENNSEPL
VKKIKPKVVSRTIFHKKSNQLENHTIVGTRSTRSGSRNGDQWVMNAGGFVERACTLGRIR
SLPKALIDMHLSKSVSKSDSDLIAYPSNEKTSRVNWSESSTAEHSSKGNSERTPSFTSEW
EEIDKIMSSIDVGINNELKEMNGETTRPRCPVQTVGQWLESIGLPQYENHLMANGFDNVQ
FMGSNVMEDQDLLEIGILNSGHRQRILQAIQLLPKMRPIGHDGYHPTSVAEWLDSIELGD
YTKAFLINGYTSMDLLKKIWEVELINVLKINLIGHRKRILASLGDRLHDDPPQKPPRSIT
LREPSGNHTPPQLSPSLSQSTYTTGGSLDVPHIIMQGDARRRRNENYFDDIPRSKLERQM
AQTGDWGEPSITLRPPNEATASTPVQYWQHHPEKLIFQSCDYKAFYLGSMLIKELRGTES
TQDACAKMRANCQKSTEQMKKVPTIILSVSYKGVKFIDATNKNIIAEHEIRNISCAAQDP
EDLSTFAYITKDLKSNHHYCHVFTAFDVNLAYEIILTLGQAFEVAYQLALQARKGGHSST
LPESFENKPSKPIPKPRVSIRKSVDLLHASHTGQEPSERHTEEALRKF

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:P0C6S7	0.283	0.281	0.000	1260	0.925	0.916	P0C6S7.pdb.gz	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
2	AFDB:Q93203	0.203	0.216	6.436E-35	1170	0.203	0.216	Q93203.pdb.gz	Q93203_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C11E4.6 PE=1 SV=2
3	PDB:8cs9A	0.191	0.296	1.620E-13	796	0.071	0.112	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
4	AFDB:Q8N2N9	0.182	0.169	5.223E-12	1353	0.100	0.092	Q8N2N9.pdb.gz	AN36B_HUMAN Ankyrin repeat domain-containing protein 36B OS=Homo sapiens OX=9606 GN=ANKRD36B PE=1 SV=4
5	AFDB:A2A690	0.176	0.112	9.819E-12	1994	0.131	0.082	A2A690.pdb.gz	TANC2_MOUSE Protein TANC2 OS=Mus musculus OX=10090 GN=Tanc2 PE=1 SV=1
6	AFDB:Q0VGY8	0.182	0.126	1.287E-11	1856	0.133	0.089	Q0VGY8.pdb.gz	TANC1_MOUSE Protein TANC1 OS=Mus musculus OX=10090 GN=Tanc1 PE=1 SV=2
7	PDB:4oauC	0.182	0.313	1.344E-11	692	0.064	0.116	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
8	PDB:5vkqA	0.189	0.158	1.022E-10	1499	0.056	0.047	5vkqA.pdb.gz
9	PDB:2dvwA	0.147	0.653	2.200E-10	229	0.057	0.310	2dvwA.pdb.gz
10	PDB:6v9hC	0.162	0.711	1.066E-9	270	0.050	0.233	6v9hC.pdb.gz
11	PDB:1wg0A	0.147	0.646	7.409E-9	243	0.045	0.230	1wg0A.pdb.gz
12	PDB:6aunA	0.170	0.332	1.595E-8	618	0.053	0.107	6aunA.pdb.gz
13	PDB:6pqpA	0.159	0.311	4.299E-8	615	0.049	0.099	6pqpA.pdb.gz	Structural Insights into Electrophile Irritant Sensing by the Human TRPA1 Channel.
14	PDB:6jd6B	0.118	0.714	1.904E-7	192	0.039	0.255	6jd6B.pdb.gz
15	PDB:1bd8A	0.118	0.880	9.649E-7	156	0.042	0.340	1bd8A.pdb.gz
16	AFDB:Q6UB98	0.090	0.058	3.573E-6	2062	0.138	0.083	Q6UB98.pdb.gz	ANR12_HUMAN Ankyrin repeat domain-containing protein 12 OS=Homo sapiens OX=9606 GN=ANKRD12 PE=1 SV=3
17	AFDB:Q6UB99	0.092	0.047	1.103E-5	2663	0.100	0.047	Q6UB99.pdb.gz	ANR11_HUMAN Ankyrin repeat domain-containing protein 11 OS=Homo sapiens OX=9606 GN=ANKRD11 PE=1 SV=3
18	AFDB:E9Q4F7	0.092	0.046	1.445E-5	2643	0.104	0.049	E9Q4F7.pdb.gz	ANR11_MOUSE Ankyrin repeat domain-containing protein 11 OS=Mus musculus OX=10090 GN=Ankrd11 PE=1 SV=1
19	AFDB:Q63HR2	0.091	0.082	5.590E-5	1409	0.108	0.096	Q63HR2.pdb.gz	TENS2_HUMAN Tensin-2 OS=Homo sapiens OX=9606 GN=TNS2 PE=1 SV=2
20	AFDB:Q8IZW8	0.093	0.157	8.361E-4	715	0.099	0.173	Q8IZW8.pdb.gz	TENS4_HUMAN Tensin-4 OS=Homo sapiens OX=9606 GN=TNS4 PE=1 SV=3

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A3B3ISP1	0.0	578	1194	0.260	0.271	A0A3B3ISP1_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
2	J3QSU0	0.0	682	332	0.266	1.000	J3QSU0_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1B (Fragment) OS=Homo sapiens OX=9606 GN=ANKS1B PE=1 SV=2
3	P0C6S7	0.0	2340	1260	0.926	0.917	ANS1B_RAT Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Rattus norvegicus OX=10116 GN=Anks1b PE=1 SV=1
4	P59672	0.0	582	1150	0.264	0.287	ANS1A_MOUSE Ankyrin repeat and SAM domain-containing protein 1A OS=Mus musculus OX=10090 GN=Anks1a PE=1 SV=3
5	Q7Z6G8	0.0	2592	1248	1.000	1.000	ANS1B_HUMAN Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Homo sapiens OX=9606 GN=ANKS1B PE=1 SV=2
6	Q8BIZ1	0.0	2339	1259	0.926	0.918	ANS1B_MOUSE Ankyrin repeat and sterile alpha motif domain-containing protein 1B OS=Mus musculus OX=10090 GN=Anks1b PE=1 SV=3
7	Q92625	0.0	580	1134	0.260	0.286	ANS1A_HUMAN Ankyrin repeat and SAM domain-containing protein 1A OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=4
8	Q49AR9	4.97e-168	513	570	0.211	0.461	Q49AR9_HUMAN ANKS1A protein OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
9	A0A3B3ITU5	5.31e-130	408	455	0.185	0.508	A0A3B3ITU5_HUMAN Ankyrin repeat and sterile alpha motif domain containing 1A (Fragment) OS=Homo sapiens OX=9606 GN=ANKS1A PE=1 SV=1
10	Q8VHK2	3.58e-55	213	1430	0.093	0.081	CSKI1_RAT Caskin-1 OS=Rattus norvegicus OX=10116 GN=Caskin1 PE=1 SV=1
11	Q8WXD9	1.02e-54	212	1431	0.092	0.080	CSKI1_HUMAN Caskin-1 OS=Homo sapiens OX=9606 GN=CASKIN1 PE=1 SV=1
12	F1MB71	8.00e-36	150	1361	0.065	0.060	F1MB71_BOVIN CASK interacting protein 1 OS=Bos taurus OX=9913 GN=CASKIN1 PE=4 SV=3
13	Q93203	7.01e-32	137	1170	0.079	0.085	Q93203_CAEEL ANK_REP_REGION domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=C11E4.6 PE=1 SV=2
14	Q12955	1.45e-28	127	4377	0.065	0.019	ANK3_HUMAN Ankyrin-3 OS=Homo sapiens OX=9606 GN=ANK3 PE=1 SV=3
15	O70511	6.61e-28	125	2622	0.067	0.032	ANK3_RAT Ankyrin-3 OS=Rattus norvegicus OX=10116 GN=Ank3 PE=1 SV=3
16	G5E8K5	1.43e-27	124	1961	0.070	0.044	ANK3_MOUSE Ankyrin-3 OS=Mus musculus OX=10090 GN=Ank3 PE=1 SV=1
17	M9MRX4	1.70e-27	124	13559	0.065	0.006	M9MRX4_DROME Ankyrin 2, isoform U OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
18	F1M5N3	1.73e-27	124	3966	0.075	0.023	F1M5N3_RAT Ankyrin 2 OS=Rattus norvegicus OX=10116 GN=Ank2 PE=1 SV=4
19	X2JCM1	1.84e-27	124	11634	0.065	0.007	X2JCM1_DROME Ankyrin 2, isoform AA OS=Drosophila melanogaster OX=7227 GN=Ank2 PE=1 SV=1
20	A0A5F9ZHF7	2.50e-27	123	3862	0.068	0.022	A0A5F9ZHF7_HUMAN Ankyrin 2 OS=Homo sapiens OX=9606 GN=ANK2 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.1e-27	105.0	Ankyrin repeat
2	PF12796 Ank_2	2.6e-34	129.0	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	5.1e-27	101.8	Ankyrin repeat
4	PF13637 Ank_4	7e-29	111.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	7.9e-33	123.4	Ankyrin repeats (many copies)
6	PF00640 PID	1.1e-16	72.6	Phosphotyrosine interaction domain (PTB/PID)
7	PF14719 PID_2	21	16.5	Phosphotyrosine interaction domain (PTB/PID)
8	PF08416 PTB	17	17.0	Phosphotyrosine-binding domain
9	PF00536 SAM_1	2e-31	119.5	SAM domain (Sterile alpha motif)
10	PF07647 SAM_2	1.5e-24	97.2	SAM domain (Sterile alpha motif)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000449629

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000382428	0.906	Disks large homolog 4
2	9606.ENSP00000403636	0.702	Ras/Rap GTPase-activating protein SynGAP
3	9606.ENSP00000353462	0.640	Cas scaffolding protein family member 4
4	9606.ENSP00000274938	0.637	Signal peptide, CUB and EGF-like domain-containing protein 3
5	9606.ENSP00000370724	0.606	Protein FAM49A
6	9606.ENSP00000429150	0.606	Protein FAM49B
7	9606.ENSP00000399013	0.568	Contactin-associated protein-like 5
8	9606.ENSP00000354633	0.559	Transcription initiation factor TFIID subunit 11
9	9606.ENSP00000275815	0.555	Ephrin type-A receptor 1
10	9606.ENSP00000229769	0.542	Fanconi anemia group E protein
11	9606.ENSP00000035383	0.536	Leucine-rich repeat-containing protein 7
12	9606.ENSP00000316377	0.532	Disks large-associated protein 1
13	9606.ENSP00000280772	0.531	Ankyrin-3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0019899	0.810	enzyme binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.998	cellular process
GO:0050794	0.987	regulation of cellular process
GO:0050896	0.931	response to stimulus
GO:0099536	0.904	synaptic signaling
GO:0051716	0.881	cellular response to stimulus
GO:0097120	0.874	receptor localization to synapse
GO:0007165	0.867	signal transduction
GO:0032501	0.617	multicellular organismal process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.999	cytoplasm
GO:0043231	0.995	intracellular membrane-bounded organelle
GO:0030054	0.992	cell junction
GO:0005886	0.992	plasma membrane
GO:0005654	0.985	nucleoplasm
GO:0043232	0.981	intracellular non-membrane-bounded organelle
GO:0005829	0.977	cytosol
GO:0045202	0.973	synapse
GO:0005856	0.703	cytoskeleton
GO:0098794	0.504	postsynapse
GO:0098978	0.396	glutamatergic synapse
GO:0098793	0.301	presynapse

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]