StarFunc result for job id Q7Z6I6

User Input

>input (1101 residues)
MKSRQKGKKKGSAKERVFGCDLQEHLQHSGQEVPQVLKSCAEFVEEYGVVDGIYRLSGVS
SNIQKLRQEFESERKPDLRRDVYLQDIHCVSSLCKAYFRELPDPLLTYRLYDKFAEAVGV
QLEPERLVKILEVLRELPVPNYRTLEFLMRHLVHMASFSAQTNMHARNLAIVWAPNLLRS
KDIEASGFNGTAAFMEVRVQSIVVEFILTHVDQLFGGAALSGGEVESGWRSLPGTRASGS
PEDLMPRPLPYHLPSILQAGDGPPQMRPYHTIIEIAEHKRKGSLKVRKWRSIFNLGRSGH
ETKRKLPRGAEDREDKSNKGTLRPAKSMDSLSAAAGASDEPEGLVGPSSPRPSPLLPESL
ENDSIEAAEGEQEPEAEALGGTNSEPGTPRAGRSAIRAGGSSRAERCAGVHISDPYNVNL
PLHITSILSVPPNIISNVSLARLTRGLECPALQHRPSPASGPGPGPGLGPGPPDEKLEAS
PASSPLADSGPDDLAPALEDSLSQEVQDSFSFLEDSSSSEPEWVGAEDGEVAQAEAAGAA
FSPGEDDPGMGYLEELLGVGPQVEEFSVEPPLDDLSLDEAQFVLAPSCCSLDSAGPRPEV
EEENGEEVFLSAYDDLSPLLGPKPPIWKGSGSLEGEAAGCGRQALGQGGEEQACWEVGED
KQAEPGGRLDIREEAEGSPETKVEAGKASEDRGEAGGSQETKVRLREGSREETEAKEEKS
KGQKKADSMEAKGVEEPGGDEYTDEKEKEIEREEDEQREEAQVEAGRDLEQGAQEDQVAE
EKWEVVQKQEAEGVREDEDKGQREKGYHEARKDQGDGEDSRSPEAATEGGAGEVSKERES
GDGEAEGDQRAGGYYLEEDTLSEGSGVASLEVDCAKEGNPHSSEMEEVAPQPPQPEEMEP
EGQPSPDGCLCPCSLGLGGVGMRLASTLVQVQQVRSVPVVPPKPQFAKMPSAMCSKIHVA
PANPCPRPGRLDGTPGERAWGSRASRSSWRNGGSLSFDAAVALARDRQRTEAQGVRRTQT
CTEGGDYCLIPRTSPCSMISAHSPRPLSCLELPSEGAEGSGSRSRLSLPPREPQVPDPLL
SSQRRSYAFETQANPGKGEGL

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6I6	1.000	1.000	0.000	1101	1.000	1.000	Q7Z6I6.pdb.gz	RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=3
2	AFDB:A0A0A0MRJ9	0.252	0.297	1.261E-86	890	0.807	0.999	A0A0A0MRJ9.pdb.gz	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
3	AFDB:A6X8Z5	0.216	0.171	4.144E-28	1425	0.317	0.245	A6X8Z5.pdb.gz	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
4	AFDB:Q2M1Z3	0.218	0.170	3.509E-26	1444	0.309	0.235	Q2M1Z3.pdb.gz	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
5	AFDB:F1MAK3	0.193	0.103	8.286E-26	2101	0.292	0.153	F1MAK3.pdb.gz	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
6	AFDB:D4A9G6	0.191	0.161	1.598E-24	1310	0.268	0.225	D4A9G6.pdb.gz	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
7	AFDB:A7KAX9	0.183	0.100	9.799E-24	2087	0.284	0.150	A7KAX9.pdb.gz	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
8	AFDB:Q9VIS1	0.177	0.106	4.102E-23	1843	0.269	0.161	Q9VIS1.pdb.gz	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
9	AFDB:Q9VDS5	0.181	0.267	3.654E-13	740	0.114	0.169	Q9VDS5.pdb.gz	RG92B_DROME Rho GTPase-activating protein 92B OS=Drosophila melanogaster OX=7227 GN=RhoGAP92B PE=1 SV=1
10	PDB:3cxlA	0.173	0.468	2.225E-12	402	0.061	0.167	3cxlA.pdb.gz	Crystal structure of human chimerin 1 (CHN1).
11	PDB:6r3vA	0.168	0.893	2.307E-11	198	0.053	0.293	6r3vA.pdb.gz	A GAP-GTPase-GDP-PiIntermediate Crystal Structure Analyzed by DFT Shows GTP Hydrolysis Involves Serial Proton Transfers.
12	PDB:1xa6A	0.173	0.470	2.538E-11	399	0.059	0.163	1xa6A.pdb.gz	Structural mechanism for lipid activation of the Rac-specific GAP, beta2-chimaerin.
13	AFDB:Q6DFV3	0.178	0.105	2.950E-11	1944	0.151	0.085	Q6DFV3.pdb.gz	RHG21_MOUSE Rho GTPase-activating protein 21 OS=Mus musculus OX=10090 GN=Arhgap21 PE=1 SV=2
14	PDB:5jcpA	0.158	0.472	7.170E-10	361	0.050	0.152	5jcpA.pdb.gz	Structural Basis for the Specific Recognition of RhoA by the Dual GTPase-activating Protein ARAP3
15	PDB:5c2kA	0.153	0.426	2.026E-8	382	0.051	0.147	5c2kA.pdb.gz	Structural basis of G-protein target alternation of MgcRacGAP by phospholylation
16	PDB:6yl2B	0.053	0.178	4.410E-1	192	0.021	0.120	6yl2B.pdb.gz	Structural and DNA binding studies of the transcriptional repressor Rv2506 (BkaR) from Mycobacterium tuberculosis supports a role in L-Leucine catabolism
17	PDB:6pyzA	0.045	0.102	7.108E-1	353	0.022	0.068	6pyzA.pdb.gz	Structural Basis of Inhibitor Selectivity in Human Indoleamine 2,3-Dioxygenase 1 and Tryptophan Dioxygenase.
18	PDB:6jhoA	0.069	0.213	9.465E-1	200	0.024	0.130	6jhoA.pdb.gz
19	PDB:6gn0A	0.066	0.182	1.322	239	0.025	0.113	6gn0A.pdb.gz
20	PDB:7nvoB	0.056	0.134	1.678	282	0.028	0.110	7nvoB.pdb.gz	Snapshots of actin and tubulin folding inside the TRiC chaperonin.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	A0A0A0MRJ8	0.0	1828	924	0.837	0.998	A0A0A0MRJ8_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
2	A0A0A0MRJ9	0.0	1366	890	0.616	0.762	A0A0A0MRJ9_HUMAN Rho GTPase activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=1
3	Q7Z6I6	0.0	2204	1101	1.000	1.000	RHG30_HUMAN Rho GTPase-activating protein 30 OS=Homo sapiens OX=9606 GN=ARHGAP30 PE=1 SV=3
4	A7KAX9	3.56e-103	360	2087	0.182	0.096	RHG32_HUMAN Rho GTPase-activating protein 32 OS=Homo sapiens OX=9606 GN=ARHGAP32 PE=1 SV=1
5	F1MAK3	5.16e-103	360	2101	0.182	0.095	F1MAK3_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=1 SV=2
6	Q811P8	5.21e-103	360	2089	0.181	0.095	RHG32_MOUSE Rho GTPase-activating protein 32 OS=Mus musculus OX=10090 GN=Arhgap32 PE=1 SV=2
7	A0A8I6GIC6	5.82e-103	360	2061	0.182	0.097	A0A8I6GIC6_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
8	A0A8I5Y6H2	6.25e-103	360	2046	0.182	0.098	A0A8I5Y6H2_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
9	A6X8Z5	7.60e-102	353	1425	0.175	0.135	RHG31_MOUSE Rho GTPase-activating protein 31 OS=Mus musculus OX=10090 GN=Arhgap31 PE=1 SV=1
10	Q2M1Z3	1.25e-101	353	1444	0.177	0.135	RHG31_HUMAN Rho GTPase-activating protein 31 OS=Homo sapiens OX=9606 GN=ARHGAP31 PE=1 SV=2
11	A1A5D2	1.03e-91	312	748	0.135	0.199	A1A5D2_HUMAN SNX26 protein OS=Homo sapiens OX=9606 GN=SNX26 PE=1 SV=1
12	Q80YF9	6.31e-89	315	1305	0.163	0.137	RHG33_MOUSE Rho GTPase-activating protein 33 OS=Mus musculus OX=10090 GN=Arhgap33 PE=1 SV=1
13	A0A8I6AJS5	8.59e-89	314	1309	0.163	0.137	A0A8I6AJS5_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=3 SV=1
14	D4A9G6	9.57e-89	315	1354	0.163	0.132	D4A9G6_RAT Rho GTPase activating protein 33 OS=Rattus norvegicus OX=10116 GN=Arhgap33 PE=1 SV=4
15	A0A8I6GFW8	2.65e-77	282	2070	0.156	0.083	A0A8I6GFW8_RAT Rho GTPase activating protein 32 OS=Rattus norvegicus OX=10116 GN=Arhgap32 PE=3 SV=1
16	Q9VIS1	3.17e-63	238	1843	0.104	0.062	CDGAP_DROME GTPase-activating protein CdGAPr OS=Drosophila melanogaster OX=7227 GN=CdGAPr PE=1 SV=2
17	Q20498	2.60e-33	140	759	0.071	0.103	RRC1_CAEEL GTPase-activating protein rrc-1 OS=Caenorhabditis elegans OX=6239 GN=rrc-1 PE=1 SV=3
18	Q6TLK4	6.19e-32	137	869	0.067	0.085	RHG27_RAT Rho GTPase-activating protein 27 OS=Rattus norvegicus OX=10116 GN=Arhgap27 PE=1 SV=1
19	Q8IWW6	1.14e-31	136	846	0.071	0.092	RHG12_HUMAN Rho GTPase-activating protein 12 OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1
20	Q1RLN5	1.38e-31	135	799	0.071	0.098	Q1RLN5_HUMAN ARHGAP12 protein OS=Homo sapiens OX=9606 GN=ARHGAP12 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00620 RhoGAP	1.1e-39	147.2	RhoGAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000356992

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000356990	0.776	Kelch domain containing 9
2	9606.ENSP00000219150	0.744	Coronin-1A
3	9606.ENSP00000377380	0.674	Rho GTPase-activating protein 9
4	9606.ENSP00000279227	0.660	Fermitin family homolog 3
5	9606.ENSP00000294507	0.631	Lysosomal-associated transmembrane protein 5
6	9606.ENSP00000411355	0.605	Receptor-type tyrosine-protein phosphatase C
7	9606.ENSP00000380948	0.596	Integrin beta-2
8	9606.ENSP00000363330	0.586	CAMPATH-1 antigen
9	9606.ENSP00000256935	0.584	Dedicator of cytokinesis protein 2
10	9606.ENSP00000349359	0.581	SAM and SH3 domain-containing protein 3
11	9606.ENSP00000359045	0.580	Rho GTPase-activating protein 4
12	9606.ENSP00000246115	0.579	Sphingosine 1-phosphate receptor 4
13	9606.ENSP00000355652	0.576	Rho-related GTP-binding protein RhoU
14	9606.ENSP00000227752	0.571	Interleukin-10 receptor subunit alpha
15	9606.ENSP00000289707	0.567	SLAM family member 8
16	9606.ENSP00000293373	0.567	Nck-associated protein 1-like
17	9606.ENSP00000328083	0.567	Rho guanine nucleotide exchange factor 37
18	9606.ENSP00000356505	0.566	Neutrophil cytosol factor 2
19	9606.ENSP00000380334	0.566	Neutrophil cytosol factor 4
20	9606.ENSP00000361345	0.558	Protein FAM78A

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0005096	1.000	GTPase activator activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.999	regulation of cellular process
GO:0010646	0.977	regulation of cell communication
GO:0023051	0.974	regulation of signaling
GO:0048583	0.945	regulation of response to stimulus
GO:0009966	0.898	regulation of signal transduction
GO:1902531	0.889	regulation of intracellular signal transduction
GO:0051056	0.869	regulation of small GTPase mediated signal transduction
GO:0009987	0.693	cellular process
GO:0050896	0.590	response to stimulus
GO:0051716	0.371	cellular response to stimulus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0043231	0.999	intracellular membrane-bounded organelle
GO:0005829	0.989	cytosol
GO:0071944	0.508	cell periphery
GO:0005886	0.499	plasma membrane
GO:0005634	0.355	nucleus

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]