StarFunc result for job id Q7Z6J0

User Input

>input (888 residues)
MDESALLDLLECPVCLERLDASAKVLPCQHTFCKRCLLGIVGSRNELRCPECRTLVGSGV
EELPSNILLVRLLDGIKQRPWKPGPGGGSGTNCTNALRSQSSTVANCSSKDLQSSQGGQQ
PRVQSWSPPVRGIPQLPCAKALYNYEGKEPGDLKFSKGDIIILRRQVDENWYHGEVNGIH
GFFPTNFVQIIKPLPQPPPQCKALYDFEVKDKEADKDCLPFAKDDVLTVIRRVDENWAEG
MLADKIGIFPISYVEFNSAAKQLIEWDKPPVPGVDAGECSSAAAQSSTAPKHSDTKKNTK
KRHSFTSLTMANKSSQASQNRHSMEISPPVLISSSNPTAAARISELSGLSCSAPSQVHIS
TTGLIVTPPPSSPVTTGPSFTFPSDVPYQAALGTLNPPLPPPPLLAATVLASTPPGATAA
AAAAGMGPRPMAGSTDQIAHLRPQTRPSVYVAIYPYTPRKEDELELRKGEMFLVFERCQD
GWFKGTSMHTSKIGVFPGNYVAPVTRAVTNASQAKVPMSTAGQTSRGVTMVSPSTAGGPA
QKLQGNGVAGSPSVVPAAVVSAAHIQTSPQAKVLLHMTGQMTVNQARNAVRTVAAHNQER
PTAAVTPIQVQNAAGLSPASVGLSHHSLASPQPAPLMPGSATHTAAISISRASAPLACAA
AAPLTSPSITSASLEAEPSGRIVTVLPGLPTSPDSASSACGNSSATKPDKDSKKEKKGLL
KLLSGASTKRKPRVSPPASPTLEVELGSAELPLQGAVGPELPPGGGHGRAGSCPVDGDGP
VTTAVAGAALAQDAFHRKASSLDSAVPIAPPPRQACSSLGPVLNESRPVVCERHRVVVSY
PPQSEAELELKEGDIVFVHKKREDGWFKGTLQRNGKTGLFPGSFVENI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q71F54	0.212	0.211	0.000	894	0.913	0.907	Q71F54.pdb.gz	SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus OX=10116 GN=Sh3rf1 PE=1 SV=1
2	AFDB:Q6NRD3	0.195	0.207	6.535E-88	826	0.682	0.734	Q6NRD3.pdb.gz	SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis OX=8355 GN=sh3rf1 PE=1 SV=1
3	AFDB:Q8TEJ3	0.234	0.235	2.963E-66	882	0.483	0.486	Q8TEJ3.pdb.gz	SH3R3_HUMAN E3 ubiquitin-protein ligase SH3RF3 OS=Homo sapiens OX=9606 GN=SH3RF3 PE=1 SV=2
4	AFDB:Q7K4D1	0.145	0.151	2.741E-50	838	0.306	0.325	Q7K4D1.pdb.gz	Q7K4D1_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=POSH PE=1 SV=1
5	AFDB:Q08AM8	0.163	0.197	6.296E-45	729	0.291	0.354	Q08AM8.pdb.gz	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
6	AFDB:Q1LYG0	0.074	0.060	1.160E-18	1119	0.152	0.121	Q1LYG0.pdb.gz	SPD2A_DANRE SH3 and PX domain-containing protein 2A OS=Danio rerio OX=7955 GN=sh3pxd2a PE=3 SV=2
7	AFDB:Q5TCZ1	0.087	0.073	2.612E-18	1133	0.158	0.124	Q5TCZ1.pdb.gz	SPD2A_HUMAN SH3 and PX domain-containing protein 2A OS=Homo sapiens OX=9606 GN=SH3PXD2A PE=1 SV=1
8	AFDB:Q8R550	0.073	0.089	2.278E-17	709	0.142	0.178	Q8R550.pdb.gz	SH3K1_MOUSE SH3 domain-containing kinase-binding protein 1 OS=Mus musculus OX=10090 GN=Sh3kbp1 PE=1 SV=1
9	AFDB:A0A0B4KI34	0.096	0.092	1.356E-14	941	0.182	0.172	A0A0B4KI34.pdb.gz	A0A0B4KI34_DROME CIN85 and CD2AP related, isoform J OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=1
10	AFDB:Q9VA36	0.078	0.079	4.227E-14	882	0.166	0.167	Q9VA36.pdb.gz	Q9VA36_DROME CIN85 and CD2AP related, isoform C OS=Drosophila melanogaster OX=7227 GN=cindr PE=1 SV=2
11	PDB:1griA	0.062	0.242	6.503E-7	211	0.046	0.194	1griA.pdb.gz
12	PDB:2lqnA	0.067	0.183	3.678E-6	303	0.037	0.109	2lqnA.pdb.gz
13	PDB:2dybA	0.070	0.206	9.746E-6	298	0.029	0.087	2dybA.pdb.gz
14	PDB:2eyzA	0.105	0.244	5.818E-5	304	0.043	0.125	2eyzA.pdb.gz
15	PDB:6x5hA	0.065	0.123	1.542E-4	467	0.018	0.034	6x5hA.pdb.gz	Characterizing human alpha-1,6-fucosyltransferase (FUT8) substrate specificity and structural similarities with related fucosyltransferases.
16	PDB:1k9aB	0.063	0.126	1.915E-4	441	0.027	0.054	1k9aB.pdb.gz
17	PDB:3ehqA	0.061	0.286	5.074E-4	182	0.021	0.104	3ehqA.pdb.gz
18	PDB:3qwyA	0.062	0.309	5.654E-4	170	0.019	0.100	3qwyA.pdb.gz
19	PDB:2h8hA	0.062	0.124	1.026E-3	445	0.023	0.045	2h8hA.pdb.gz	N-(5-chloro-1,3-benzodioxol-4-yl)-7-[2-(4-methylpiperazin-1-yl)ethoxy]-5- (tetrahydro-2H-pyran-4-yloxy)quinazolin-4-amine, a novel, highly selective, orally available, dual-specific c-Src/Abl kinase inhibitor.
20	PDB:1k0xA	0.064	0.471	1.670E-3	108	0.018	0.148	1k0xA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q69ZI1	0.0	1558	892	0.908	0.904	SH3R1_MOUSE E3 ubiquitin-protein ligase SH3RF1 OS=Mus musculus OX=10090 GN=Sh3rf1 PE=1 SV=2
2	Q6NRD3	0.0	1058	826	0.679	0.730	SH3R1_XENLA E3 ubiquitin-protein ligase SH3RF1 OS=Xenopus laevis OX=8355 GN=sh3rf1 PE=1 SV=1
3	Q71F54	0.0	1531	894	0.910	0.904	SH3R1_RAT E3 ubiquitin-protein ligase SH3RF1 OS=Rattus norvegicus OX=10116 GN=Sh3rf1 PE=1 SV=1
4	Q7Z6J0	0.0	1803	888	1.000	1.000	SH3R1_HUMAN E3 ubiquitin-protein ligase SH3RF1 OS=Homo sapiens OX=9606 GN=SH3RF1 PE=1 SV=2
5	Q8TEJ3	0.0	638	882	0.465	0.468	SH3R3_HUMAN E3 ubiquitin-protein ligase SH3RF3 OS=Homo sapiens OX=9606 GN=SH3RF3 PE=1 SV=2
6	Q08AM8	4.87e-107	348	729	0.230	0.280	Q08AM8_HUMAN SH3 domain containing ring finger 2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=1
7	Q8TEC5	7.79e-107	348	729	0.255	0.310	SH3R2_HUMAN E3 ubiquitin-protein ligase SH3RF2 OS=Homo sapiens OX=9606 GN=SH3RF2 PE=1 SV=3
8	Q498M5	3.58e-76	265	735	0.206	0.249	SH3R2_RAT E3 ubiquitin-protein ligase SH3RF2 OS=Rattus norvegicus OX=10116 GN=Sh3rf2 PE=1 SV=1
9	Q7K4D1	1.05e-66	241	838	0.136	0.144	Q7K4D1_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=POSH PE=1 SV=1
10	Q9NHP2	1.21e-66	241	838	0.136	0.144	Q9NHP2_DROME RING-type E3 ubiquitin transferase OS=Drosophila melanogaster OX=7227 GN=POSH PE=1 SV=1
11	Q966U7	1.33e-23	104	313	0.057	0.163	Q966U7_DROME CAP, isoform E OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
12	Q8IGB7	3.32e-23	104	350	0.057	0.146	Q8IGB7_DROME RH64582p (Fragment) OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
13	B7YZD9	9.17e-23	107	2365	0.057	0.022	B7YZD9_DROME CAP, isoform L OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
14	B7YZD8	9.61e-23	107	2412	0.057	0.021	B7YZD8_DROME CAP, isoform Q OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=2
15	A0A0B4KEJ6	9.77e-23	107	1586	0.057	0.032	A0A0B4KEJ6_DROME CAP, isoform W OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
16	D3DMM3	9.97e-23	105	554	0.057	0.092	D3DMM3_DROME CAP, isoform S OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
17	A0A0B4KEH7	1.05e-22	107	2409	0.057	0.021	A0A0B4KEH7_DROME CAP, isoform Y OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
18	A1Z871	1.05e-22	107	1734	0.057	0.029	A1Z871_DROME CAP, isoform B OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1
19	Q966V0	1.06e-22	107	1743	0.057	0.029	Q966V0_DROME CAP, isoform R OS=Drosophila melanogaster OX=7227 GN=CAP PE=2 SV=1
20	A1Z867	1.08e-22	107	2376	0.057	0.021	A1Z867_DROME CAP, isoform A OS=Drosophila melanogaster OX=7227 GN=CAP PE=4 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF14447 Prok-RING_4	29	16.0	Prokaryotic RING finger family 4
2	PF00018 SH3_1	3.2e-46	166.0	SH3 domain
3	PF07653 SH3_2	7.2e-31	117.1	Variant SH3 domain
4	PF14604 SH3_9	2.9e-49	176.1	Variant SH3 domain
5	PF00097 zf-C3HC4	1.8e-05	35.8	Zinc finger, C3HC4 type (RING finger)
6	PF13923 zf-C3HC4_2	1.7e-05	35.8	Zinc finger, C3HC4 type (RING finger)
7	PF13920 zf-C3HC4_3	0.0041	28.2	Zinc finger, C3HC4 type (RING finger)
8	PF15227 zf-C3HC4_4	3.1	19.3	zinc finger of C3HC4-type, RING
9	PF02891 zf-MIZ	7.6e+02	11.3	MIZ/SP-RING zinc finger
10	PF11789 zf-Nse	9e+02	11.2	Zinc-finger of the MIZ type in Nse subunit
11	PF17123 zf-RING_11	36	15.5	RING-like zinc finger
12	PF13639 zf-RING_2	7.4e-05	34.3	Ring finger domain
13	PF14570 zf-RING_4	4	18.6	RING/Ubox like zinc-binding domain
14	PF14634 zf-RING_5	0.01	27.1	zinc-RING finger domain
15	PF13445 zf-RING_UBOX	2.6e-05	35.5	RING-type zinc-finger

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000284637

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000309597	0.985	Mitogen-activated protein kinase kinase kinase 11
2	9606.ENSP00000394560	0.942	Mitogen-activated protein kinase 9
3	9606.ENSP00000341551	0.902	Mothers against decapentaplegic homolog 4
4	9606.ENSP00000375892	0.883	RAC-beta serine/threonine-protein kinase
5	9606.ENSP00000451828	0.880	RAC-alpha serine/threonine-protein kinase
6	9606.ENSP00000370003	0.806	BCL2/adenovirus E1B 19 kDa protein-interacting protein 3-like
7	9606.ENSP00000265026	0.735	Mitogen-activated protein kinase kinase kinase 13
8	9606.ENSP00000296043	0.704	Protein Shroom3
9	9606.ENSP00000322457	0.699	E3 ubiquitin-protein ligase SIAH2
10	9606.ENSP00000349156	0.697	E3 ubiquitin-protein ligase SIAH1
11	9606.ENSP00000262013	0.695	C-Jun-amino-terminal kinase-interacting protein 4
12	9606.ENSP00000348461	0.663	Ras-related C3 botulinum toxin substrate 1
13	9606.ENSP00000367196	0.659	Golgi-associated plant pathogenesis-related protein 1
14	9606.ENSP00000451263	0.634	Mitogen-activated protein kinase kinase kinase 9
15	9606.ENSP00000316176	0.601	Ubiquitin-conjugating enzyme E2 N
16	9606.ENSP00000291536	0.599	Radial spoke head 1 homolog
17	9606.ENSP00000349722	0.591	Ubiquitin conjugating enzyme E2 D3
18	9606.ENSP00000264933	0.577	Programmed cell death protein 6
19	9606.ENSP00000354201	0.576	Ubiquitin-conjugating enzyme E2 Z
20	9606.ENSP00000360116	0.567	Ubiquitin-conjugating enzyme E2 U

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding
GO:0140096	0.981	catalytic activity, acting on a protein
GO:0016740	0.977	transferase activity
GO:0019787	0.935	ubiquitin-like protein transferase activity
GO:0004842	0.929	ubiquitin-protein transferase activity
GO:0061659	0.770	ubiquitin-like protein ligase activity
GO:0061630	0.748	ubiquitin protein ligase activity

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0050794	0.996	regulation of cellular process
GO:0048518	0.974	positive regulation of biological process
GO:0048583	0.969	regulation of response to stimulus
GO:0009966	0.956	regulation of signal transduction
GO:0009987	0.943	cellular process
GO:0008152	0.910	metabolic process
GO:0048522	0.904	positive regulation of cellular process
GO:0071704	0.901	organic substance metabolic process
GO:0044238	0.893	primary metabolic process
GO:0006807	0.878	nitrogen compound metabolic process
GO:0043170	0.867	macromolecule metabolic process
GO:1901564	0.859	organonitrogen compound metabolic process
GO:0019538	0.854	protein metabolic process
GO:0019222	0.808	regulation of metabolic process
GO:0070302	0.743	regulation of stress-activated protein kinase signaling cascade
GO:0060255	0.738	regulation of macromolecule metabolic process
GO:0036211	0.734	protein modification process
GO:0080090	0.701	regulation of primary metabolic process
GO:0009967	0.596	positive regulation of signal transduction
GO:0043408	0.537	regulation of MAPK cascade
GO:0051171	0.535	regulation of nitrogen compound metabolic process
GO:0048523	0.525	negative regulation of cellular process
GO:1902533	0.510	positive regulation of intracellular signal transduction
GO:0050896	0.464	response to stimulus
GO:0070647	0.440	protein modification by small protein conjugation or removal
GO:0032502	0.373	developmental process
GO:0044237	0.368	cellular metabolic process
GO:0032501	0.364	multicellular organismal process
GO:0048856	0.359	anatomical structure development
GO:0043410	0.345	positive regulation of MAPK cascade
GO:0009893	0.342	positive regulation of metabolic process
GO:0031323	0.335	regulation of cellular metabolic process
GO:0010604	0.332	positive regulation of macromolecule metabolic process
GO:0065009	0.325	regulation of molecular function
GO:0032872	0.310	regulation of stress-activated MAPK cascade

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005829	0.999	cytosol
GO:0043226	0.942	organelle
GO:0005634	0.926	nucleus
GO:0070013	0.853	intracellular organelle lumen
GO:0031981	0.821	nuclear lumen
GO:0005654	0.790	nucleoplasm
GO:0016020	0.729	membrane
GO:0071944	0.420	cell periphery
GO:0120025	0.373	plasma membrane bounded cell projection
GO:0005886	0.302	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name
EC:2.-.-.-	0.977	Transferases.

[back to server]