StarFunc result for job id Q7Z6K1

User Input

>input (395 residues)
MPRYCAAICCKNRRGRNNKDRKLSFYPFPLHDKERLEKWLKNMKRDSWVPSKYQFLCSDH
FTPDSLDIRWGIRYLKQTAVPTIFSLPEDNQGKDPSKKKSQKKNLEDEKEVCPKAKSEES
FVLNETKKNIVNTDVPHQHPELLHSSSLVKPPAPKTGSIQNNMLTLNLVKQHTGKPESTL
ETSVNQDTGRGGFHTCFENLNSTTITLTTSNSESIHQSLETQEVLEVTTSHLANPNFTSN
SMEIKSAQENPFLFSTINQTVEELNTNKESVIAIFVPAENSKPSVNSFISAQKETTEMED
TDIEDSLYKDVDYGTEVLQIEHSYCRQDINKEHLWQKVSKLHSKITLLELKEQQTLGRLK
SLEALIRQLKQENWLSEENVKIIENHFTTYEVTMI

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6K1	1.000	1.000	1.292E-59	395	1.000	1.000	Q7Z6K1.pdb.gz	THAP5_HUMAN THAP domain-containing protein 5 OS=Homo sapiens OX=9606 GN=THAP5 PE=1 SV=2
2	AFDB:Q8WY91	0.234	0.163	3.186E-12	577	0.223	0.153	Q8WY91.pdb.gz	THAP4_HUMAN Peroxynitrite isomerase THAP4 OS=Homo sapiens OX=9606 GN=THAP4 PE=1 SV=2
3	AFDB:M9PG25	0.103	0.072	1.194E-1	568	0.099	0.069	M9PG25.pdb.gz	M9PG25_DROME Bub3 interacting GLEBS and zinc finger domain protein, isoform E OS=Drosophila melanogaster OX=7227 GN=BuGZ PE=1 SV=1
4	AFDB:O13606	0.092	0.075	1.365E-1	517	0.132	0.101	O13606.pdb.gz	MEI4_SCHPO Meiosis-specific transcription factor mei4 OS=Schizosaccharomyces pombe (strain 972 / ATCC 24843) OX=284812 GN=mei4 PE=4 SV=1
5	AFDB:A0A0G2K5P5	0.095	0.030	2.855E-1	1688	0.104	0.024	A0A0G2K5P5.pdb.gz	A0A0G2K5P5_RAT Myomesin 1 OS=Rattus norvegicus OX=10116 GN=Myom1 PE=1 SV=2
6	AFDB:Q13129	0.070	0.019	7.301E-1	1914	0.124	0.026	Q13129.pdb.gz	RLF_HUMAN Zinc finger protein Rlf OS=Homo sapiens OX=9606 GN=RLF PE=1 SV=2
7	AFDB:Q5SZL2	0.083	0.053	7.301E-1	805	0.129	0.063	Q5SZL2.pdb.gz	CE85L_HUMAN Centrosomal protein of 85 kDa-like OS=Homo sapiens OX=9606 GN=CEP85L PE=1 SV=1
8	AFDB:P53976	0.066	0.048	9.548E-1	612	0.134	0.087	P53976.pdb.gz	YNB8_YEAST Uncharacterized protein YNL018C OS=Saccharomyces cerevisiae (strain ATCC 204508 / S288c) OX=559292 GN=YNL018C PE=4 SV=1
9	AFDB:Q3TYX8	0.118	0.088	9.548E-1	563	0.109	0.076	Q3TYX8.pdb.gz	RUFY4_MOUSE RUN and FYVE domain-containing protein 4 OS=Mus musculus OX=10090 GN=Rufy4 PE=2 SV=3
10	AFDB:Q9N593	0.070	0.042	9.548E-1	788	0.114	0.057	Q9N593.pdb.gz	CDC27_CAEEL Cell division cycle protein 27 homolog OS=Caenorhabditis elegans OX=6239 GN=mat-1 PE=1 SV=1
11	PDB:7v2wJ	0.099	0.151	5.927	236	0.063	0.106	7v2wJ.pdb.gz
12	PDB:5lj5O	0.069	0.090	8.863	283	0.058	0.081	5lj5O.pdb.gz	Cryo-EM structure of the spliceosome immediately after branching.

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z6K1	0.0	815	395	1.000	1.000	THAP5_HUMAN THAP domain-containing protein 5 OS=Homo sapiens OX=9606 GN=THAP5 PE=1 SV=2
2	Q8NA92	2.64e-28	114	274	0.144	0.208	THAP8_HUMAN THAP domain-containing protein 8 OS=Homo sapiens OX=9606 GN=THAP8 PE=1 SV=1
3	Q8WY91	4.91e-22	100	577	0.122	0.083	THAP4_HUMAN Peroxynitrite isomerase THAP4 OS=Homo sapiens OX=9606 GN=THAP4 PE=1 SV=2
4	Q8WTV1	5.29e-13	70.5	239	0.099	0.163	THAP3_HUMAN THAP domain-containing protein 3 OS=Homo sapiens OX=9606 GN=THAP3 PE=1 SV=1
5	Q9NVV9	6.36e-13	69.7	213	0.091	0.169	THAP1_HUMAN THAP domain-containing protein 1 OS=Homo sapiens OX=9606 GN=THAP1 PE=1 SV=1
6	Q9H0W7	1.27e-12	68.9	228	0.091	0.158	THAP2_HUMAN THAP domain-containing protein 2 OS=Homo sapiens OX=9606 GN=THAP2 PE=1 SV=1
7	Q9BT49	2.41e-10	63.5	309	0.091	0.117	THAP7_HUMAN THAP domain-containing protein 7 OS=Homo sapiens OX=9606 GN=THAP7 PE=1 SV=2
8	Q9H5L6	7.70e-09	60.1	903	0.094	0.041	THAP9_HUMAN DNA transposase THAP9 OS=Homo sapiens OX=9606 GN=THAP9 PE=1 SV=2
9	Q9VJ27	5.02e-08	57.4	762	0.091	0.047	Q9VJ27_DROME Uncharacterized protein, isoform A OS=Drosophila melanogaster OX=7227 GN=Dmel\CG10431 PE=4 SV=3
10	Q8TBB0	2.27e-07	53.5	222	0.091	0.162	THAP6_HUMAN THAP domain-containing protein 6 OS=Homo sapiens OX=9606 GN=THAP6 PE=1 SV=1
11	O43422	1.23e-04	46.6	761	0.096	0.050	P52K_HUMAN 52 kDa repressor of the inhibitor of the protein kinase OS=Homo sapiens OX=9606 GN=THAP12 PE=1 SV=2
12	Q9CUX1	3.08e-04	45.4	758	0.091	0.047	P52K_MOUSE 52 kDa repressor of the inhibitor of the protein kinase OS=Mus musculus OX=10090 GN=Thap12 PE=2 SV=2
13	Q9P2Z0	0.016	39.3	257	0.073	0.113	THA10_HUMAN THAP domain-containing protein 10 OS=Homo sapiens OX=9606 GN=THAP10 PE=1 SV=1
14	Q22360	0.051	38.5	954	0.053	0.022	Q22360_CAEEL High Incidence of Males (Increased X chromosome loss) OS=Caenorhabditis elegans OX=6239 GN=him-17 PE=1 SV=1
15	P0DUJ8	0.68	34.3	348	0.073	0.083	SSEK2_SALTS Protein-arginine N-acetylglucosaminyltransferase SseK2 OS=Salmonella typhimurium (strain SL1344) OX=216597 GN=sseK2 PE=1 SV=1
16	Q8ZNP4	0.68	34.3	348	0.073	0.083	SSEK2_SALTY Protein-arginine N-acetylglucosaminyltransferase SseK2 OS=Salmonella typhimurium (strain LT2 / SGSC1412 / ATCC 700720) OX=99287 GN=sseK2 PE=3 SV=1
17	P55036	5.0	31.6	377	0.041	0.042	PSMD4_HUMAN 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1
18	Q5VWC4	5.1	31.6	380	0.041	0.042	Q5VWC4_HUMAN 26S proteasome non-ATPase regulatory subunit 4 OS=Homo sapiens OX=9606 GN=PSMD4 PE=1 SV=1
19	Q9ESH1	5.1	31.6	377	0.041	0.042	Q9ESH1_RAT 26S proteasome non-ATPase regulatory subunit 4 OS=Rattus norvegicus OX=10116 GN=Psmd4 PE=1 SV=1
20	Q9VAP6	5.2	31.6	503	0.048	0.038	Q9VAP6_DROME Autophagy-related 14 OS=Drosophila melanogaster OX=7227 GN=Atg14 PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF11559 ADIP	6.3	18.4	Afadin- and alpha -actinin-Binding
2	PF05485 THAP	1.3e-14	66.1	THAP domain

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000400500

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000298492	0.826	BRISC complex subunit Abraxas 2
2	9606.ENSP00000304689	0.790	THAP domain-containing protein 11
3	9606.ENSP00000309555	0.673	Host cell factor 1
4	9606.ENSP00000260045	0.663	52 kDa repressor of the inhibitor of the protein kinase
5	9606.ENSP00000249861	0.651	THAP domain containing 10
6	9606.ENSP00000249356	0.552	DnaJ homolog subfamily B member 9
7	9606.ENSP00000410804	0.510	Calcium-independent phospholipase A2-gamma

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0002020	1.000	protease binding
GO:1901363	0.498	heterocyclic compound binding
GO:0097159	0.498	organic cyclic compound binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051726	0.988	regulation of cell cycle
GO:0045786	0.979	negative regulation of cell cycle
GO:0006355	0.966	regulation of DNA-templated transcription
GO:0000122	0.961	negative regulation of transcription by RNA polymerase II
GO:0009987	0.710	cellular process
GO:0071704	0.425	organic substance metabolic process
GO:0044238	0.328	primary metabolic process
GO:0006807	0.313	nitrogen compound metabolic process
GO:0043170	0.300	macromolecule metabolic process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005654	0.999	nucleoplasm
GO:0000785	0.996	chromatin
GO:0005737	0.440	cytoplasm

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]