StarFunc result for job id Q7Z6K4

User Input

>input (114 residues)
MSQAELSTCSAPQTQRIFQEAVRKGNTQELQSLLQNMTNCEFNVNSFGPEGQTALHQSVI
DGNLELVKLLVKFGADIRLANRDGWSALHIAAFGGHQDIVLYLITKAKYAASGR

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:Q7Z6K4	1.000	1.000	1.134E-18	114	1.000	1.000	Q7Z6K4.pdb.gz	NRARP_HUMAN Notch-regulated ankyrin repeat-containing protein OS=Homo sapiens OX=9606 GN=NRARP PE=1 SV=1
2	AFDB:Q7T3X9	0.794	0.813	6.041E-13	111	0.851	0.874	Q7T3X9.pdb.gz	NARPB_DANRE Notch-regulated ankyrin repeat-containing protein B OS=Danio rerio OX=7955 GN=nrarpb PE=2 SV=1
3	PDB:6py8B	0.700	0.825	2.076E-9	95	0.798	0.958	6py8B.pdb.gz	Extension of the Notch intracellular domain ankyrin repeat stack by NRARP promotes feedback inhibition of Notch signaling.
4	AFDB:Q90623	0.685	0.086	5.320E-6	1004	0.316	0.036	Q90623.pdb.gz	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
5	AFDB:Q10728	0.687	0.084	6.658E-6	1032	0.307	0.034	Q10728.pdb.gz	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
6	AFDB:Q6DRG7	0.678	0.081	6.658E-6	1049	0.298	0.032	Q6DRG7.pdb.gz	MYPT1_DANRE Protein phosphatase 1 regulatory subunit 12A OS=Danio rerio OX=7955 GN=ppp1r12a PE=2 SV=2
7	AFDB:M9PCQ3	0.673	0.077	1.043E-5	1111	0.289	0.030	M9PCQ3.pdb.gz	M9PCQ3_DROME Myosin binding subunit, isoform Q OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
8	AFDB:Q86RA0	0.672	0.092	1.167E-5	927	0.289	0.036	Q86RA0.pdb.gz	Q86RA0_DROME Myosin phosphatase DMBS-L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=2 SV=1
9	AFDB:Q86WC6	0.675	0.510	1.167E-5	154	0.307	0.227	Q86WC6.pdb.gz	PPR27_HUMAN Protein phosphatase 1 regulatory subunit 27 OS=Homo sapiens OX=9606 GN=PPP1R27 PE=1 SV=1
10	AFDB:M9NDA1	0.673	0.069	1.305E-5	1230	0.289	0.027	M9NDA1.pdb.gz	M9NDA1_DROME Myosin binding subunit, isoform L OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1
11	AFDB:F8VZN8	0.673	0.121	1.381E-5	692	0.307	0.051	F8VZN8.pdb.gz	F8VZN8_HUMAN Protein phosphatase 1 regulatory subunit 12A (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
12	PDB:3ehqA	0.672	0.434	6.687E-5	182	0.254	0.159	3ehqA.pdb.gz
13	PDB:8cs9A	0.661	0.100	9.364E-5	796	0.228	0.033	8cs9A.pdb.gz	Architecture of the human erythrocyte ankyrin-1 complex.
14	PDB:4bszB	0.677	0.523	1.108E-4	150	0.219	0.167	4bszB.pdb.gz
15	PDB:6jd6B	0.657	0.410	1.467E-4	192	0.211	0.125	6jd6B.pdb.gz
16	PDB:4oauC	0.633	0.117	3.600E-4	692	0.175	0.029	4oauC.pdb.gz	Structure of human RNase L reveals the basis for regulated RNA decay in the IFN response.
17	PDB:7df7B	0.651	0.626	3.600E-4	119	0.219	0.210	7df7B.pdb.gz
18	PDB:6v9hC	0.660	0.294	1.045E-3	270	0.211	0.089	6v9hC.pdb.gz
19	PDB:2dvwA	0.662	0.339	1.384E-3	229	0.228	0.114	2dvwA.pdb.gz
20	PDB:6mwqA	0.636	0.159	1.464E-3	493	0.263	0.061	6mwqA.pdb.gz

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z6K4	1.83e-82	238	114	1.000	1.000	NRARP_HUMAN Notch-regulated ankyrin repeat-containing protein OS=Homo sapiens OX=9606 GN=NRARP PE=1 SV=1
2	Q91ZA8	1.83e-82	238	114	1.000	1.000	NRARP_MOUSE Notch-regulated ankyrin repeat-containing protein OS=Mus musculus OX=10090 GN=Nrarp PE=1 SV=1
3	Q7T3Y0	9.32e-73	213	112	0.886	0.902	NARPA_DANRE Notch-regulated ankyrin repeat-containing protein A OS=Danio rerio OX=7955 GN=nrarpa PE=2 SV=1
4	Q7T3X9	2.26e-68	202	111	0.860	0.883	NARPB_DANRE Notch-regulated ankyrin repeat-containing protein B OS=Danio rerio OX=7955 GN=nrarpb PE=2 SV=1
5	Q86WC6	1.72e-17	74.7	154	0.307	0.227	PPR27_HUMAN Protein phosphatase 1 regulatory subunit 27 OS=Homo sapiens OX=9606 GN=PPP1R27 PE=1 SV=1
6	G5EEB3	2.34e-14	69.7	1016	0.333	0.037	G5EEB3_CAEEL MEL-11 OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
7	G5EG29	2.36e-14	69.7	968	0.333	0.039	G5EG29_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
8	G5EGT0	2.46e-14	69.7	1019	0.333	0.037	G5EGT0_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
9	G5ECD7	2.80e-14	69.7	1124	0.333	0.034	G5ECD7_CAEEL cGMP-dependent protein kinase interacting domain-containing protein OS=Caenorhabditis elegans OX=6239 GN=mel-11 PE=1 SV=1
10	Q90623	9.20e-13	65.1	1004	0.316	0.036	MYPT1_CHICK Protein phosphatase 1 regulatory subunit 12A OS=Gallus gallus OX=9031 GN=PPP1R12A PE=1 SV=1
11	A0A0S2Z4Q8	1.77e-12	62.4	184	0.289	0.179	A0A0S2Z4Q8_HUMAN Protein phosphatase 1 regulatory subunit 12B isoform 2 OS=Homo sapiens OX=9606 GN=PPP1R12B PE=1 SV=1
12	F8VZN8	2.48e-12	63.9	692	0.307	0.051	F8VZN8_HUMAN Protein phosphatase 1 regulatory subunit 12A (Fragment) OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
13	Q8BG95	4.22e-12	63.2	976	0.289	0.034	MYPT2_MOUSE Protein phosphatase 1 regulatory subunit 12B OS=Mus musculus OX=10090 GN=Ppp1r12b PE=1 SV=2
14	Q8SY34	5.87e-12	62.8	741	0.263	0.040	Q8SY34_DROME LD46604p OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=2 SV=1
15	M9PFV2	6.43e-12	62.8	635	0.263	0.047	M9PFV2_DROME Myosin phosphatase targeting subunit 75D, isoform B OS=Drosophila melanogaster OX=7227 GN=MYPT-75D PE=4 SV=1
16	O14974	1.20e-11	62.0	1030	0.307	0.034	MYPT1_HUMAN Protein phosphatase 1 regulatory subunit 12A OS=Homo sapiens OX=9606 GN=PPP1R12A PE=1 SV=1
17	Q10728	1.20e-11	62.0	1032	0.307	0.034	MYPT1_RAT Protein phosphatase 1 regulatory subunit 12A OS=Rattus norvegicus OX=10116 GN=Ppp1r12a PE=1 SV=2
18	Q9DBR7	1.20e-11	62.0	1029	0.307	0.034	MYPT1_MOUSE Protein phosphatase 1 regulatory subunit 12A OS=Mus musculus OX=10090 GN=Ppp1r12a PE=1 SV=2
19	E1BC59	1.22e-11	62.0	1028	0.307	0.034	E1BC59_BOVIN Protein phosphatase 1 regulatory subunit OS=Bos taurus OX=9913 GN=PPP1R12A PE=4 SV=3
20	M9NFZ0	2.12e-11	61.2	341	0.289	0.097	M9NFZ0_DROME Myosin binding subunit, isoform P OS=Drosophila melanogaster OX=7227 GN=Mbs PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF00023 Ank	3.1e-06	38.6	Ankyrin repeat
2	PF12796 Ank_2	4.4e-13	60.9	Ankyrin repeats (3 copies)
3	PF13606 Ank_3	1.7e-08	44.9	Ankyrin repeat
4	PF13637 Ank_4	5.4e-11	54.1	Ankyrin repeats (many copies)
5	PF13857 Ank_5	5.6e-10	50.5	Ankyrin repeats (many copies)

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 1026970.XP_008829420.1

Rank	PPI partner	STRING score	Description
1	1026970.XP_008840189.1	0.833	Notch 1
2	1026970.XP_008835566.1	0.813	Recombination signal binding protein for immunoglobulin kappa J region
3	1026970.XP_008828742.1	0.656	Notch 2
4	1026970.XP_008821105.1	0.644	Serine/threonine-protein phosphatase PP1-alpha catalytic subunit
5	1026970.XP_008826632.1	0.644	Protein phosphatase 1 catalytic subunit beta
6	1026970.XP_008837623.1	0.644	Serine/threonine-protein phosphatase PP1-gamma catalytic subunit isoform X1
7	1026970.XP_008826530.1	0.621	Protein naked cuticle homolog 1
8	1026970.XP_008822634.1	0.594	Citron Rho-interacting kinase isoform X1
9	1026970.XP_008828608.1	0.589	Protein phosphatase 1 regulatory subunit 15B
10	1026970.XP_008825406.1	0.580	Jagged 1
11	1026970.XP_008852121.1	0.570	Protein phosphatase 1 regulatory inhibitor subunit 14A
12	1026970.XP_008828211.1	0.553	Notch 3
13	1026970.XP_008849623.1	0.549	LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase
14	1026970.XP_008845705.1	0.535	Deltex E3 ubiquitin ligase 1
15	1026970.XP_008845002.1	0.534	Delta-like protein 4
16	1026970.XP_008820577.1	0.532	CDC42 binding protein kinase alpha
17	1026970.XP_008854588.1	0.512	Protein jagged-2
18	1026970.XP_008841623.1	0.501	Delta like canonical Notch ligand 1

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0009987	0.997	cellular process
GO:0050794	0.997	regulation of cellular process
GO:0007275	0.996	multicellular organism development
GO:0009653	0.994	anatomical structure morphogenesis
GO:0048731	0.994	system development
GO:0048519	0.992	negative regulation of biological process
GO:0060429	0.983	epithelium development
GO:0048646	0.980	anatomical structure formation involved in morphogenesis
GO:0035239	0.980	tube morphogenesis
GO:0001944	0.978	vasculature development
GO:0050896	0.975	response to stimulus
GO:0048523	0.974	negative regulation of cellular process
GO:0002040	0.968	sprouting angiogenesis
GO:0030155	0.965	regulation of cell adhesion
GO:0001935	0.963	endothelial cell proliferation
GO:0022407	0.962	regulation of cell-cell adhesion
GO:0061138	0.959	morphogenesis of a branching epithelium
GO:0007219	0.946	Notch signaling pathway
GO:0008593	0.942	regulation of Notch signaling pathway
GO:0048754	0.932	branching morphogenesis of an epithelial tube
GO:0001569	0.910	branching involved in blood vessel morphogenesis
GO:0023057	0.857	negative regulation of signaling
GO:0010648	0.845	negative regulation of cell communication
GO:0048518	0.835	positive regulation of biological process
GO:0019222	0.833	regulation of metabolic process
GO:0009968	0.831	negative regulation of signal transduction
GO:0060255	0.819	regulation of macromolecule metabolic process
GO:0030154	0.807	cell differentiation
GO:0048468	0.796	cell development
GO:0007162	0.789	negative regulation of cell adhesion
GO:0051239	0.762	regulation of multicellular organismal process
GO:0045746	0.752	negative regulation of Notch signaling pathway
GO:0048522	0.744	positive regulation of cellular process
GO:0050793	0.743	regulation of developmental process
GO:0045595	0.686	regulation of cell differentiation
GO:0080090	0.626	regulation of primary metabolic process
GO:0010468	0.617	regulation of gene expression
GO:0051171	0.580	regulation of nitrogen compound metabolic process
GO:0031323	0.531	regulation of cellular metabolic process
GO:0051241	0.510	negative regulation of multicellular organismal process
GO:0019219	0.507	regulation of nucleobase-containing compound metabolic process
GO:0048513	0.480	animal organ development
GO:0022408	0.470	negative regulation of cell-cell adhesion
GO:0051093	0.468	negative regulation of developmental process
GO:0010556	0.467	regulation of macromolecule biosynthetic process
GO:0031326	0.467	regulation of cellular biosynthetic process
GO:0045596	0.463	negative regulation of cell differentiation
GO:0006355	0.459	regulation of DNA-templated transcription
GO:0009892	0.455	negative regulation of metabolic process
GO:0050865	0.441	regulation of cell activation
GO:2000026	0.435	regulation of multicellular organismal development
GO:0002682	0.424	regulation of immune system process
GO:0010605	0.424	negative regulation of macromolecule metabolic process
GO:0050866	0.422	negative regulation of cell activation
GO:0042127	0.388	regulation of cell population proliferation
GO:0060284	0.345	regulation of cell development
GO:0031324	0.320	negative regulation of cellular metabolic process
GO:0051172	0.317	negative regulation of nitrogen compound metabolic process
GO:0050863	0.313	regulation of T cell activation
GO:0002683	0.310	negative regulation of immune system process

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0005737	0.998	cytoplasm
GO:0043231	0.997	intracellular membrane-bounded organelle
GO:0005654	0.993	nucleoplasm
GO:0005829	0.704	cytosol
GO:0043228	0.474	non-membrane-bounded organelle
GO:0043232	0.442	intracellular non-membrane-bounded organelle
GO:0016020	0.422	membrane
GO:0071944	0.380	cell periphery
GO:0005886	0.363	plasma membrane

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]