StarFunc result for job id Q7Z6K5

User Input

>input (226 residues)
MSRIYHDGALRNKAVQSVRLPGAWDPAAHQGGNGVLLEGELIDVSRHSILDTHGRKERYY
VLYIRPSHIHRRKFDAKGNEIEPNFSATRKVNTGFLMSSYKVEAKGDTDRLTPEALKGLV
NKPELLALTESLTPDHTVAFWMPESEMEVMELELGAGVRLKTRGDGPFLDSLAKLEAGTV
TKCNFTGDGKTGASWTDNIMAQKCSKGAAAEIREQGDGAEDEEWDD

Proteins with similar structure

Top structural analogs (as identified by Foldseek and TM-align)

Rank	Structure template	TM-score1	TM-score2	Foldseek E-value	Length	ID1	ID2	Download	Description
1	AFDB:A0A0A6YYH1	0.801	0.471	3.950E-39	394	0.991	0.569	A0A0A6YYH1.pdb.gz	A0A0A6YYH1_HUMAN Arpin OS=Homo sapiens OX=9606 GN=C15orf38-AP3S2 PE=3 SV=1
2	AFDB:Q9D0A3	0.829	0.829	3.233E-36	226	0.885	0.885	Q9D0A3.pdb.gz	ARPIN_MOUSE Arpin OS=Mus musculus OX=10090 GN=Arpin PE=1 SV=1
3	AFDB:Q1LWJ6	0.846	0.846	4.410E-31	226	0.593	0.593	Q1LWJ6.pdb.gz	ARPIN_DANRE Arpin OS=Danio rerio OX=7955 GN=arpin PE=2 SV=1
4	AFDB:H0YL85	0.401	0.479	7.950E-14	185	0.540	0.659	H0YL85.pdb.gz	H0YL85_HUMAN Arpin (Fragment) OS=Homo sapiens OX=9606 GN=ARPIN-AP3S2 PE=3 SV=1
5	AFDB:Q54F87	0.621	0.626	2.274E-12	224	0.212	0.214	Q54F87.pdb.gz	ARPIN_DICDI Arpin OS=Dictyostelium discoideum OX=44689 GN=arpin PE=3 SV=1
6	PDB:7f5yB	0.180	0.285	9.529E-2	120	0.084	0.158	7f5yB.pdb.gz
7	PDB:6jauA	0.114	0.094	1.130E-1	283	0.111	0.088	6jauA.pdb.gz	Molecular basis of the lipid-induced MucA-MucB dissociation in Pseudomonas aeruginosa.
8	PDB:6jlaD	0.104	0.119	1.502E-1	188	0.071	0.085	6jlaD.pdb.gz	Structures of three ependymin-related proteins suggest their function as a hydrophobic molecule binder.
9	PDB:7ungX	0.080	0.035	1.682E-1	701	0.093	0.030	7ungX.pdb.gz	SPACA9 is a lumenal protein of human ciliary singlet and doublet microtubules.
10	AFDB:Q6K0P9	0.139	0.069	1.855E-1	492	0.133	0.061	Q6K0P9.pdb.gz	IFIX_HUMAN Pyrin and HIN domain-containing protein 1 OS=Homo sapiens OX=9606 GN=PYHIN1 PE=1 SV=1
11	PDB:7odeL	0.102	0.121	1.885E-1	183	0.075	0.093	7odeL.pdb.gz	Structural Consequences of Deproteinating the 50S Ribosome.
12	PDB:7qxbP	0.124	0.113	2.235E-1	251	0.093	0.084	7qxbP.pdb.gz	Structural basis of human telomerase recruitment by TPP1-POT1.
13	PDB:8d0bB	0.150	0.098	2.235E-1	362	0.102	0.064	8d0bB.pdb.gz	Structures of the human CST-Pol alpha-primase complex bound to telomere templates.
14	PDB:7kgbD	0.117	0.117	2.366E-1	213	0.071	0.075	7kgbD.pdb.gz	Discovery of natural-product-derived sequanamycins as potent oral anti-tuberculosis agents.
15	AFDB:Q9M2X5	0.251	0.132	2.465E-1	473	0.097	0.047	Q9M2X5.pdb.gz	Q9M2X5_ARATH RuvB-like helicase OS=Arabidopsis thaliana OX=3702 GN=T16K5.180 PE=1 SV=1
16	PDB:1iwmA	0.099	0.116	2.651E-1	177	0.062	0.079	1iwmA.pdb.gz
17	PDB:7rroT	0.097	0.066	2.806E-1	452	0.128	0.064	7rroT.pdb.gz	De novo identification of mammalian ciliary motility proteins using cryo-EM.
18	AFDB:Q09289	0.092	0.066	3.094E-1	374	0.119	0.072	Q09289.pdb.gz	ADRM1_CAEEL Proteasomal ubiquitin receptor ADRM1 homolog OS=Caenorhabditis elegans OX=6239 GN=rpn-13 PE=1 SV=2
19	AFDB:Q07864	0.219	0.027	3.466E-1	2286	0.119	0.012	Q07864.pdb.gz	DPOE1_HUMAN DNA polymerase epsilon catalytic subunit A OS=Homo sapiens OX=9606 GN=POLE PE=1 SV=5
20	AFDB:Q96HH9	0.107	0.065	4.111E-1	432	0.093	0.049	Q96HH9.pdb.gz	GRM2B_HUMAN GRAM domain-containing protein 2B OS=Homo sapiens OX=9606 GN=GRAMD2B PE=1 SV=1

(a)	The query structure is shown in cartoon, while the structural analog is displayed using a backbone trace.
(b)	Ranking of proteins is based on E-value of Foldseek alignment.
(c)	TM-score1 and ID1 are TM-score and sequence identity normalized by query sequence length.
(d)	TM-score2 and ID2 are TM-score and sequence identity normalized by template sequence length.

Proteins with similar sequence

Top sequence homologs in UniProt

Rank	Template	E-value	Bit-score	Length	ID1	ID2	Description
1	Q7Z6K5	4.57e-170	468	226	1.000	1.000	ARPIN_HUMAN Arpin OS=Homo sapiens OX=9606 GN=ARPIN PE=1 SV=1
2	A0A0A6YYH1	1.75e-167	468	394	0.991	0.569	A0A0A6YYH1_HUMAN Arpin OS=Homo sapiens OX=9606 GN=C15orf38-AP3S2 PE=3 SV=1
3	Q9D0A3	3.53e-150	418	226	0.885	0.885	ARPIN_MOUSE Arpin OS=Mus musculus OX=10090 GN=Arpin PE=1 SV=1
4	Q1LWJ6	1.01e-96	283	226	0.593	0.593	ARPIN_DANRE Arpin OS=Danio rerio OX=7955 GN=arpin PE=2 SV=1
5	H0YL85	6.52e-90	264	185	0.566	0.692	H0YL85_HUMAN Arpin (Fragment) OS=Homo sapiens OX=9606 GN=ARPIN-AP3S2 PE=3 SV=1
6	H0YMK0	4.80e-32	117	184	0.239	0.293	H0YMK0_HUMAN Arpin (Fragment) OS=Homo sapiens OX=9606 GN=ARPIN-AP3S2 PE=3 SV=1
7	Q54F87	4.32e-08	53.9	224	0.235	0.237	ARPIN_DICDI Arpin OS=Dictyostelium discoideum OX=44689 GN=arpin PE=3 SV=1
8	Q53EL9	2.0	32.0	994	0.137	0.031	SEZ6_HUMAN Seizure protein 6 homolog OS=Homo sapiens OX=9606 GN=SEZ6 PE=1 SV=2
9	Q2TBE0	2.1	32.0	894	0.075	0.019	C19L2_HUMAN CWF19-like protein 2 OS=Homo sapiens OX=9606 GN=CWF19L2 PE=1 SV=4
10	Q92ET8	2.9	31.2	254	0.102	0.091	GOLR_LISIN HTH-type transcriptional regulator GolR OS=Listeria innocua serovar 6a (strain ATCC BAA-680 / CLIP 11262) OX=272626 GN=golR PE=4 SV=1
11	Q9UHA7	7.9	29.3	158	0.058	0.082	IL36A_HUMAN Interleukin-36 alpha OS=Homo sapiens OX=9606 GN=IL36A PE=1 SV=1

(a)	Ranking of proteins is based on the E-value of a BLASTp alignment.
(b)	ID1 and ID2 are sequence identities normalized by the query and template sequence lengths, respectively.

Pfam families

Top Pfam family matches

Rank	Pfam family	E-value	Score	Description
1	PF01893 UPF0058	67	15.2	Uncharacterised protein family UPF0058
2	PF10574 UPF0552	3.8e-105	361.8	Arp2/3-interacting proteins Arpin

(a)	Ranking of Pfam families is based on the E-value provided by HMMsearch.

Protein-protein interaction (PPI) partners

Top PPI partners to 9606.ENSP00000350075

Rank	PPI partner	STRING score	Description
1	9606.ENSP00000360689	0.932	Tankyrase-2
2	9606.ENSP00000381377	0.803	C15orf38-AP3S2 readthrough
3	9606.ENSP00000338777	0.540	AP-3 complex subunit sigma-2
4	9606.ENSP00000432472	0.536	Protein BRICK1
5	9606.ENSP00000441786	0.517	UPF0428 protein CXorf56
6	9606.ENSP00000386557	0.506	Uncharacterized membrane protein C19orf24
7	9606.ENSP00000240079	0.505	WASH complex subunit 3

A higher STRING score indicates a greater likelihood of interaction.
The query and PPI partners are shown as grey oval and white rectangles, respectively.
Interactions between query and PPI partners are shown by solid black lines. Interactions among PPI partners are by dashed grey lines.
Values in the rectangles are the STRING scores between query and each corresponding PPI partner

Predicted Gene Ontology (GO) Terms

GO term	C-score	Name
GO:0005515	1.000	protein binding

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Molecular Function (MF) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0008150	1.000	biological_process
GO:0051125	0.989	regulation of actin nucleation
GO:1902904	0.985	negative regulation of supramolecular fiber organization
GO:0010639	0.979	negative regulation of organelle organization
GO:0051494	0.969	negative regulation of cytoskeleton organization
GO:1902743	0.961	regulation of lamellipodium organization
GO:0022604	0.854	regulation of cell morphogenesis
GO:2000146	0.800	negative regulation of cell motility
GO:0030336	0.705	negative regulation of cell migration
GO:0031345	0.699	negative regulation of cell projection organization
GO:0040011	0.637	locomotion
GO:0051093	0.632	negative regulation of developmental process
GO:0009987	0.413	cellular process
GO:0051126	0.303	negative regulation of actin nucleation

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Biological Process (BP) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

GO term	C-score	Name
GO:0110165	1.000	cellular anatomical entity
GO:0005575	1.000	cellular_component
GO:0005622	0.952	intracellular anatomical structure
GO:0005737	0.938	cytoplasm
GO:0005829	0.914	cytosol
GO:0043226	0.839	organelle
GO:0031252	0.817	cell leading edge
GO:0042995	0.797	cell projection
GO:0043229	0.793	intracellular organelle
GO:0120025	0.733	plasma membrane bounded cell projection
GO:0030027	0.610	lamellipodium
GO:0043227	0.424	membrane-bounded organelle

C-score is the confidence score of a predicted GO term. Its value ranges from (0,1], where a higher value indicates a higher confidence prediction.
If a child GO term and its parent term have the same C-score, only the child term is shown in this table.

The graph shows the predicted terms for the Cellular Component (CC) GO aspect. GO terms shown in the table are colored by C-score in the graph:

[0.3,0.4)

[0.4,0.5)

[0.5,0.6)

[0.6,0.7)

[0.7,0.8)

[0.8,0.9)

[0.9,1.0]

Predicted reactions (EC numbers and Rhea reactions)

Reaction	C-score	Name

[back to server]